KEGG   Mus musculus (mouse): 16392Help
Entry
16392             CDS       T01002                                 

Gene name
Isl1
Definition
(RefSeq) ISL1 transcription factor, LIM/homeodomain
  KO
K09370  insulin gene enhancer protein ISL-1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    16392 (Isl1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    16392 (Isl1)
Transcription factors [BR:mmu03000]
 Eukaryotic Type
  Helix-turn-helix
   Homeo domain with LIM region
    16392 (Isl1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LIM Homeodomain Homeobox_KN
Motif
Other DBs
NCBI-GeneID: 16392
NCBI-ProteinID: NP_067434
MGI: 101791
Ensembl: ENSMUSG00000042258
Vega: OTTMUSG00000039739
UniProt: P61372 A2RSV5 Q8BTH7
LinkDB All DBs
Structure
PDB: 

Position
13; 13 D2.2
AA seq 349 aa AA seqDB search
MGDMGDPPKKKRLISLCVGCGNQIHDQYILRVSPDLEWHAACLKCAECNQYLDESCTCFV
RDGKTYCKRDYIRLYGIKCAKCSIGFSKNDFVMRARSKVYHIECFRCVACSRQLIPGDEF
ALREDGLFCRADHDVVERASLGAGDPLSPLHPARPLQMAAEPISARQPALRPHVHKQPEK
TTRVRTVLNEKQLHTLRTCYAANPRPDALMKEQLVEMTGLSPRVIRVWFQNKRCKDKKRS
IMMKQLQQQQPNDKTNIQGMTGTPMVAASPERHDGGLQANPVEVQSYQPPWKVLSDFALQ
SDIDQPAFQQLVNFSEGGPGSNSTGSEVASMSSQLPDTPNSMVASPIEA
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgggagacatgggcgatccaccaaaaaaaaaacgtctgatttccctgtgtgttggttgc
ggcaatcaaattcacgaccagtatattctgagggtttctccggatttggagtggcatgca
gcatgtttgaaatgtgcggagtgtaatcagtatttggacgaaagctgtacgtgctttgtt
agggatgggaaaacctactgtaaaagagattatatcaggttgtacgggatcaaatgcgcc
aagtgcagcataggcttcagcaagaacgacttcgtgatgcgtgcccgctctaaggtgtac
cacatcgagtgtttccgctgtgtagcctgcagccgacagctcatcccgggagacgaattc
gccctgcgggaggatgggcttttctgccgtgcagaccacgatgtggtggagagagccagc
ctgggagctggagaccctctcagtcccttgcatccagcgcggcctctgcaaatggcagcc
gaacccatctcggctaggcagccagctctgcggccgcacgtccacaagcagccggagaag
accacccgagtgcggactgtgctcaacgagaagcagctgcacaccttgcggacctgctat
gccgccaaccctcggccagatgcgctcatgaaggagcaactagtggagatgacgggcctc
agtcccagagtcatccgagtgtggtttcaaaacaagcggtgcaaggacaagaaacgcagc
atcatgatgaagcagctccagcagcagcaacccaacgacaaaactaatatccaggggatg
acaggaactcccatggtggctgctagtccggagagacatgatggtggtttacaggctaac
ccagtagaggtgcaaagttaccagccgccctggaaagtactgagtgacttcgccttgcaa
agcgacatagatcagcctgcttttcagcaactggtcaatttttcagaaggaggaccaggc
tctaattctactggcagtgaagtagcatcgatgtcctcgcagctcccagatacacccaac
agcatggtagccagtcctattgaggcatga

DBGET integrated database retrieval system