KEGG   Mus musculus (mouse): 16398Help
Entry
16398             CDS       T01002                                 

Gene name
Itga2, CD49B, DX5, GPIa
Definition
(RefSeq) integrin alpha 2
  KO
K06481  integrin alpha 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04145  Phagosome
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu04611  Platelet activation
mmu04640  Hematopoietic cell lineage
mmu04810  Regulation of actin cytoskeleton
mmu05165  Human papillomavirus infection
mmu05200  Pathways in cancer
mmu05205  Proteoglycans in cancer
mmu05222  Small cell lung cancer
mmu05410  Hypertrophic cardiomyopathy (HCM)
mmu05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
mmu05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    16398 (Itga2)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    16398 (Itga2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    16398 (Itga2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    16398 (Itga2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    16398 (Itga2)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    16398 (Itga2)
   04611 Platelet activation
    16398 (Itga2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    16398 (Itga2)
   05205 Proteoglycans in cancer
    16398 (Itga2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    16398 (Itga2)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    16398 (Itga2)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    16398 (Itga2)
   05414 Dilated cardiomyopathy (DCM)
    16398 (Itga2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    16398 (Itga2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    16398 (Itga2)
   04515 Cell adhesion molecules [BR:mmu04515]
    16398 (Itga2)
   04090 CD molecules [BR:mmu04090]
    16398 (Itga2)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   16398 (Itga2)
  Exosomal proteins of bladder cancer cells
   16398 (Itga2)
Cell adhesion molecules [BR:mmu04515]
 Integrins
  Integrin alpha subunits
   16398 (Itga2)
CD molecules [BR:mmu04090]
 Proteins
  16398 (Itga2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Integrin_alpha2 VWA FG-GAP VWA_2 FG-GAP_2 VCBS Integrin_alpha HisK_sensor
Motif
Other DBs
NCBI-GeneID: 16398
NCBI-ProteinID: NP_032422
MGI: 96600
Ensembl: ENSMUSG00000015533
UniProt: Q62469
LinkDB All DBs
Position
13 D2.2; 13 64.61 cM
AA seq 1178 aa AA seqDB search
MGPGQAGGALLLRLLMLVQGILNCLAYNVGLPGAKIFSGPSSEQFGYSVQQLTNPQGNWL
LVGSPWSGFPENRMGDVYKCPVDLPTATCEKLNLQNSASISNVTEIKTNMSLGLTLTRNP
GTGGFLTCGPLWAHQCGNQYYATGICSDVSPDFQFLTSFSPAVQACPSLVDVVVVCDESN
SIYPWEAVKNFLVKFVTGLDIGPKKTQVALIQYANEPRIIFNLNDFETKEDMVQATSETR
QHGGDLTNTFRAIEFARDYAYSQTSGGRPGATKVMVVVTDGESHDGSKLKTVIQQCNDDE
ILRFGIAVLGYLNRNALDTKNLIKEIKAIASTPTERYFFNVADEAALLEKAGTLGEQIFS
IEGTVQGGDNFQMEMAQVGFSADYAPQNDILMLGAVGAFDWSGTLVQETSHKPVIFPKQA
FDQVLQDRNHSSFLGYSVAAISTEDGVHFVAGAPRANYTGQIVLYSVNKQGNVTVIQSHR
GDQIGSYFGSVLCSVDVDKDTITDVLLVGAPTYMNDLKKEEGKVYLFTITKGILNQHQFL
EGPEGTGNARFGSAIAALSDINMDGFNDVIVGSPVENENSGAVYIYNGHQGTIRTKYSQK
ILGSNGAFRRHLQFFGRSLDGYGDLNGDSITDVSIGALGQVIQLWSQSIADVAIEALFTP
DKITLLNKDAKITLKLCFRAEFRPAGQNNQVAILFNMTLDADGHSSRVTSRGVFRENSER
FLQKNMVVNEVQKCSEHHISIQKPSDVVNPLDLRVDISLENPGTSPALEAYSETVKVFSI
PFYKECGSDGICISDLILDVQQLPAIQTQSFIVSNQNKRLTFSVILKNRGESAYNTVVLA
EFSENLFFASFSMPVDGTEVTCEVGSSQKSVTCDVGYPALKSEQQVTFTINFDFNLQNLQ
NQAAINFQAFSESQETNKADNSVSLTIPLLYDAELHLTRSTNINFYEISSDENAPSVIKS
VEDIGPKFIFSLKVTAGSAPVSMALVTIHIPQYTKEKNPLLYLTGIQTDQAGDISCTAEI
NPLKLPHTAPSVSFKNENFRHTKELDCRTTSCSNITCWLKDLHMKAEYFINVTTRVWNRT
FAASTFQTVQLTAAAEIDTHNPQLFVIEENAVTIPLMIMKPTEKAEVPTGVIIGSIIAGI
LLLLAMTAGLWKLGFFKRQYKKMGQNPDEMDETTELNS
NT seq 3537 nt NT seq  +upstreamnt  +downstreamnt
atgggaccgggacaggcagggggcgcgctcctgctgcggctgctaatgctagttcaaggt
attttgaattgtctggcgtataatgttggcctcccaggagcgaaaatattttccgggcct
tcaagtgaacagtttgggtattcagtacagcagcttacgaacccacaaggcaactggcta
ctggttggttcaccgtggagtggcttccctgagaaccgaatgggagatgtgtacaagtgc
cctgtggacctacccactgccacctgtgaaaagctgaatctgcaaaattcagcaagcatc
tcaaatgttaccgagataaagaccaacatgagcctgggattgaccctcaccaggaatccg
gggaccggaggctttctaacctgtggtcctctctgggcacatcagtgtggaaatcagtat
tatgcaactgggatctgttctgatgttagtccagactttcagttcttgaccagcttttca
cctgcagttcaggcttgcccttccctcgtggatgttgtagttgtatgtgatgaatcaaac
agtatttatccttgggaagcagtaaagaactttttggtaaagtttgtgacaggcctggat
ataggacctaaaaagacacaggtggcgttaattcaatatgccaatgagccgagaattata
tttaacttgaacgatttcgaaaccaaagaggatatggtccaggccacatctgagacgcgc
caacatggtggggacctcacaaacaccttcagagctatcgaattcgcaagagactacgct
tattcacagacttctggcgggcgcccgggtgctacaaaagtcatggtagttgtgaccgat
ggcgagtcccatgatgggtcgaagctgaaaactgtgatccagcaatgcaatgatgacgag
atactgaggttcggcatagcagttcttgggtatttaaacagaaatgctcttgatactaaa
aatttaatcaaagaaataaaagcaattgctagtactccaaccgagagatactttttcaat
gtggccgacgaagcggctcttctggagaaggctggaactctaggggagcaaatattcagc
attgaaggcactgttcaaggaggagacaacttccagatggaaatggcacaagttggattc
agtgcagattacgctcctcaaaatgatattctgatgttaggtgcagtgggggcttttgac
tggagtggaactcttgtccaggagacatctcacaagcccgtgatctttcctaaacaagcc
tttgaccaggttctgcaggatagaaaccacagttcgtttttaggttactctgtggctgca
atttctactgaagacggtgtccattttgttgctggtgctcctcgagcaaattatactggc
cagatagtgttgtacagcgttaacaagcaaggcaatgtgaccgtgattcagtctcacaga
ggggaccagattggctcctattttggcagtgtgctgtgctcagttgatgtagataaagac
accattacagacgtgctcctggtaggtgctcctacatacatgaacgacctcaagaaagaa
gagggaaaagtctacctatttaccatcacaaagggcatcttgaatcagcaccagtttctt
gaagggccagaaggcactggaaatgctcggtttggttcagcaattgcagccctgtcagac
atcaacatggatggctttaatgatgtgattgtcggttcacctgtagagaatgagaactct
ggagctgtgtacatttacaatggtcaccagggtaccattcgcaccaagtactcccagaaa
atccttgggtccaatggagcctttaggagacatctccagttctttggaaggtccctggat
ggctatggtgatttaaatggggattccatcactgatgtatccattggtgctttggggcaa
gtgattcaactctggtcacaaagcattgctgacgtggccatagaagctttgttcactcca
gacaaaatcactttgctcaacaaggatgctaagataaccctaaagctctgcttcagagca
gagtttagacctgctgggcaaaacaatcaagtagccatcctgtttaacatgacgcttgat
gcggacggacattcatccagggtaacctccaggggggtgttcagagaaaacagtgagcga
ttcttgcagaagaatatggtggtaaacgaagtgcagaagtgttctgagcaccacattagc
atacagaagccctctgatgttgtcaaccctttggatctgcgtgtggacatcagtttggaa
aacccaggcactagccctgccctcgaagcctattctgaaactgtcaaagtcttcagtatc
cctttctataaggagtgtggcagcgatggaatttgcatctctgacctgatcctggatgtc
caacagctgccagccattcaaactcaatcctttattgtcagtaaccaaaacaagaggtta
acattttcagtcatcctgaaaaacagaggggaaagtgcatacaacactgtggtcctggcc
gagttttctgagaacttgttttttgcttctttctccatgccggtcgatggaacagaagta
acatgtgaggttggttcatcgcagaaatctgttacctgtgatgtgggataccctgcctta
aagagtgaacagcaggtgacttttaccattaacttcgactttaatcttcaaaacctccag
aaccaggcggccatcaatttccaagccttcagtgagagccaagaaacaaacaaagcagac
aattcggtcagtctcacgattcctctcctgtatgatgccgaacttcacttaacccgatcc
accaacatcaacttctatgagatctcttcggatgagaacgctccttctgtcatcaagagt
gtcgaagatattggtcctaaattcatcttctccctcaaggtaacagccggaagtgcccca
gtgagcatggcattggtgactatccacattcctcagtacaccaaggaaaagaacccactc
ctgtatctgactgggatacaaacagaccaggctggcgacatcagctgcacagcagaaata
aatccactcaagctaccacacaccgccccttctgtatctttcaagaatgaaaacttccgg
catacgaaagaattggactgcagaaccacttcctgcagtaacatcacctgctggctgaaa
gaccttcacatgaaagcagagtacttcatcaatgtgacaaccagagtttggaacaggacc
tttgctgcttcgactttccagactgtgcagctgacagcagcggcagagatcgatacacat
aaccctcagctcttcgtgattgaggaaaatgctgtcacgattcccctcatgataatgaaa
cccacggagaaagcagaagtaccgacaggggttatcataggcagcataattgcgggaatc
cttttgctgttggctatgactgcaggtttgtggaagctcggcttcttcaaaagacaatat
aagaaaatgggccaaaatccagatgagatggatgagaccacagaactcaacagctaa

KEGG   Mus musculus (mouse): 16399Help
Entry
16399             CDS       T01002                                 

Gene name
Itga2b, AI172977, CD41, CD41B, GpIIb, alphaIIb
Definition
(RefSeq) integrin alpha 2b
  KO
K06476  integrin alpha 2B
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04015  Rap1 signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu04611  Platelet activation
mmu04640  Hematopoietic cell lineage
mmu04810  Regulation of actin cytoskeleton
mmu05165  Human papillomavirus infection
mmu05200  Pathways in cancer
mmu05222  Small cell lung cancer
mmu05410  Hypertrophic cardiomyopathy (HCM)
mmu05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
mmu05414  Dilated cardiomyopathy (DCM)
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    16399 (Itga2b)
   04151 PI3K-Akt signaling pathway
    16399 (Itga2b)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    16399 (Itga2b)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    16399 (Itga2b)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    16399 (Itga2b)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    16399 (Itga2b)
   04611 Platelet activation
    16399 (Itga2b)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    16399 (Itga2b)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    16399 (Itga2b)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    16399 (Itga2b)
   05410 Hypertrophic cardiomyopathy (HCM)
    16399 (Itga2b)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    16399 (Itga2b)
   05414 Dilated cardiomyopathy (DCM)
    16399 (Itga2b)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    16399 (Itga2b)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    16399 (Itga2b)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    16399 (Itga2b)
   04515 Cell adhesion molecules [BR:mmu04515]
    16399 (Itga2b)
   04090 CD molecules [BR:mmu04090]
    16399 (Itga2b)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     16399 (Itga2b)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   16399 (Itga2b)
Cell adhesion molecules [BR:mmu04515]
 Integrins
  Integrin alpha subunits
   16399 (Itga2b)
CD molecules [BR:mmu04090]
 Proteins
  16399 (Itga2b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS Integrin_alpha LYRIC
Motif
Other DBs
NCBI-GeneID: 16399
NCBI-ProteinID: NP_034705
MGI: 96601
Ensembl: ENSMUSG00000034664
Vega: OTTMUSG00000002857
UniProt: Q9QUM0
LinkDB All DBs
Position
11 D; 11 66.29 cM
AA seq 1033 aa AA seqDB search
MARASCAWHSLWLLQWTPLFLGPSAVPPVWALNLDSEKFSVYAGPNGSHFGFSVDFHKDK
HGSVSIVVGAPRALNASQEETGAVFLCPWKANGGKCNPLLFDLRDETRNLGFQIFQTFKT
GQGLGASVVSWNDVIVACAPWQHWNVLEKRDEAEKTPVGGCFLAQLQSGGRAEYSPCRAN
TMSSVYAESFRGDKRYCEAGFSLAVTQAGELVLGAPGGYFFLGLLARVPIENIISSYRPG
TLLWHVSNQRFTYDNSNPVFFDGYRGYSVAVGEFDGDPSTTEYVSGAPTWSWTLGAVEIL
DSYYQPLHRLHGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVYL
FLQPKGPQALSTPTLLLTGTQLYGRFGSAIAPLGDLNRDGYNDIAVAAPYGGPSGQGQVL
IFLGQSEGLSPRPSQVLDSPFPTGSGFGFSLRGAVDIDDNGYPDLIVGAYGASKVAVYRA
QPVVMATVQLMVQDSLNPTLKNCVLDQTKTPVSCFNIQMCVGATGHNIPQKLHLKAELQL
DLQKPRQGRRVLLLASQQASLTLSLDLGGRDKPICHTTGAFLRDEADFRDKLSPIVLSLN
VSLPPEETGGAPAVVLHGETHVQEQTRIILDCGEDDLCVPQLRLTATAGDSPLLIGADNV
LELKIEAANDGEGAYEAELAVHLPPGAHYMRALSNIEGFERLVCTQKKENESRVALCELG
NPMKKDTRIGITMLVSVENLEEAGESVSFQLQVRSKNSQNPNSKVVMLPVAIQAEATVEL
RGNSFPASLVVAAEEGDREQEDLDRWVSRLEHTYELHNIGPGTVNGLRLLIHIPGQSQPS
DLLYILDVQPQGGLLCSTQPSPKVDWKLSTPSPSSIRPVHHQRERRQAFLQGPKPGQQDP
VLVSCDGSASCTVVECELREMVRGQRAMVTVQVMLGLSSLRQRPQEQFVLQSHAWFNVSS
LPYSVPVVSLPSGQARVQTQLLRALEERAIPVWWVLVGVLGGLLLLTLLVLAMWKAGFFK
RNRPPLEEDEEEE
NT seq 3102 nt NT seq  +upstreamnt  +downstreamnt
atggccagagcctcctgcgcatggcattccctgtggcttctgcagtggacaccactgttc
ttgggtcctagtgctgttcctccagtctgggccttgaacctggactctgagaagttctcc
gtctatgcaggtcccaatggcagccactttggcttctcagtggactttcataaggacaaa
catggaagcgtgtccatcgtggtgggcgcccccagggccctaaacgcaagtcaagaggag
actggagccgtattcctgtgcccctggaaggccaatggtggcaagtgcaacccgttgctc
ttcgacctcagggatgagacacgaaacctaggcttccaaattttccaaaccttcaagacc
gggcaaggacttggggcgtcggtcgtcagctggaatgacgtcattgtggcctgtgccccc
tggcagcactggaatgtcctggaaaagcgcgatgaggcagagaagactccggtaggaggc
tgcttcttggctcagctccaaagcgggggccgcgcagagtactcgccctgtcgcgccaac
accatgagctccgtttacgcagagagttttcgcggagacaagcgatactgtgaagcaggc
ttcagcttggcggtgacccaggctggggagctagtgcttggagcccctggaggctacttt
tttttaggtctcctggctcgcgttccaattgagaacatcatctccagctaccgcccgggt
acccttttgtggcatgtttccaaccagcgcttcacctacgacaacagcaacccagtgttt
ttcgatggttaccggggatattcggtagccgtgggcgagtttgatggggatccgagcact
acagagtacgtatcgggtgcccccacttggagctggaccttgggagcggtggaaattttg
gactcctactaccagcccctgcaccggcttcatggagaacagatggcttcatatttcggg
cactcggtggcagtcactgacgtcaacggggacgggaggcatgacctactggtgggggct
ccattgtatatggagagcagggcagaccgcaagctggccgaggtgggccgcgtttatttg
tttctgcagcctaagggcccccaagctctgagcacacccactctcctgctgactggcacc
cagctctatgggagatttggatctgccattgcacccctgggtgacctcaaccgagacggc
tataatgatattgctgtggctgccccctatgggggtcccagtggtcagggccaagtgctg
atattcctgggtcagagtgaagggctgagtccacgcccctcccaggttctggacagcccc
ttccccacaggctctggctttggcttctcccttcgtggtgctgtagacatcgatgacaat
ggatacccagacctgattgtgggagcatatggagctagcaaggtggctgtgtacagagct
cagcctgtggtgatggccactgtccaactgatggttcaagactccctgaatccaacactg
aagaactgtgtcctggatcagaccaagacaccagtcagctgcttcaacatccagatgtgt
gtgggagccacaggacacaacattcctcagaagctgcatctaaaggcagagctgcagctg
gacttacagaagccccgtcagggccgccgggtgctcctgctggcatcccaacaggcgagc
ctcaccctgagcctggacctgggcggaagagacaagcctatctgccacaccacgggggcc
ttccttcgggatgaggccgacttccgggacaagctgagcccaattgtgctaagcctcaac
gtgtcgctgcccccagaagagactggaggagcccctgccgtggtattgcatggagaaacc
catgtccaggagcagacacggatcatcctggattgtggggaagacgacctgtgtgtgcca
cagctccggctcacagctactgcgggggactccccactcctaatcggtgctgacaatgtg
ttggagctgaagattgaagcagccaatgatggtgagggagcctatgaagcggagctggct
gtgcatctgcctccaggtgcccactacatgcgggctctcagcaacattgagggctttgag
aggcttgtctgcactcagaagaaagagaatgagtccagggtggccctctgtgagctgggc
aaccccatgaaaaaggacacccggataggaatcacaatgctggtgagtgtggagaacctg
gaagaagctggcgagtccgtgtccttccagctgcaggtcaggagcaagaacagccagaat
ccaaacagtaaggtcgtgatgttgcctgtggcaatccaagctgaagccacagtggagctt
cgagggaattccttccctgcctccctggtggtggcagcagaagaaggtgacagggagcag
gaagacttggacagatgggtctccaggctggagcacacctatgagctccacaacattggc
cctggcactgtgaatggcctcagacttctcatccacattcctggccagtcccagccctcg
gatctgctctacatcctggatgtgcagccgcagggaggtctcctttgctccacacagcca
tctcccaaggtggactggaaactatccacgcccagcccttcttccattcgccccgtccat
caccagcgtgagcgcagacaggcattcctgcaggggcccaagccagggcagcaggaccca
gttctggtgagctgcgacggctcagcgtcctgtacggtggtggagtgtgagctgcgggag
atggtgcgcgggcagcgggccatggttactgtgcaggtcatgctggggctgtccagcctc
cgccagaggccgcaggagcagtttgtgctgcagtcgcacgcctggttcaacgtctcctcc
ctaccttactcggtgccggtggtcagcttgcccagtgggcaagctcgggtgcagacacag
ctgcttcgggccttggaggagagggccattcctgtctggtgggtgctggtgggcgtgctg
ggcggtctgctgctgctgaccctgctagttttggccatgtggaaggctggcttcttcaag
cggaatcgaccgcctctggaggaagatgaagaggaagagtga

KEGG   Mus musculus (mouse): 16400Help
Entry
16400             CDS       T01002                                 

Gene name
Itga3, AA407068, CD49C, GAPB3
Definition
(RefSeq) integrin alpha 3
  KO
K06482  integrin alpha 3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu04640  Hematopoietic cell lineage
mmu04810  Regulation of actin cytoskeleton
mmu05165  Human papillomavirus infection
mmu05200  Pathways in cancer
mmu05222  Small cell lung cancer
mmu05410  Hypertrophic cardiomyopathy (HCM)
mmu05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
mmu05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    16400 (Itga3)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    16400 (Itga3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    16400 (Itga3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    16400 (Itga3)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    16400 (Itga3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    16400 (Itga3)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    16400 (Itga3)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    16400 (Itga3)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    16400 (Itga3)
   05414 Dilated cardiomyopathy (DCM)
    16400 (Itga3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    16400 (Itga3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    16400 (Itga3)
   04515 Cell adhesion molecules [BR:mmu04515]
    16400 (Itga3)
   04090 CD molecules [BR:mmu04090]
    16400 (Itga3)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   16400 (Itga3)
Cell adhesion molecules [BR:mmu04515]
 Integrins
  Integrin alpha subunits
   16400 (Itga3)
CD molecules [BR:mmu04090]
 Proteins
  16400 (Itga3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS FG-GAP_2 MTABC_N MLANA
Motif
Other DBs
NCBI-GeneID: 16400
NCBI-ProteinID: NP_038593
MGI: 96602
Ensembl: ENSMUSG00000001507
Vega: OTTMUSG00000001616
UniProt: Q62470
LinkDB All DBs
Position
11 D; 11 59.01 cM
AA seq 1053 aa AA seqDB search
MGPGPCRVPRAPGWLLRALALMVAACGRVAFAFNLDTRFLVVKEAVNPGSLFGYSVALHR
QTERQQRYLLLAGAPRDLAVGDDYTNRTGAVYLCPLTAHKDDCERMDISEKSDPDHHIIE
DMWLGVTVASQGPAGRVLVCAHRYTKVLWSGLEDQRRMVGKCYVRGNDLQLDPGDDWQTY
HNEMCNSNTDYLQTGMCQLGTSGGFTQNTVYFGAPGAYNWKGNSYMIQRKDWDLSEYSYR
GSEEQGNLYIGYTVQVGNAILHPTDIITVVTGAPRHQHMGAVFLLKQESGGDLQRKQVLK
GTQVGAYFGSAIALADLNNDGWQDLLVGAPYYFERKEEVGGAVYVFMNQAGASFPDQPSL
LLHGPSRSAFGISIASIGDINQDGFQDIAVGAPFEGLGKVYIYHSSSGGLLRQPQQIIHG
EKLGLPGLATFGYSLSGKMDVDENLYPDLLVGSLSDHIVLLRARPVINILHRTLVARPAV
LDPALCTATSCVQVELCFAYNQSAGNPNYRRNITLAYTLEADRDRRPPRLRFARSQSSVF
HGFFSMPETHCQTLELLLMDNVRDKLRPIVIAMNYSLPLRMPDRLKLGLRSLDAYPVLNQ
AQAMENHTEVHFQKECGPDNKCDSNLQMRAAFLSEQLQPLSRLQYSRDTKKLFLSINVTN
SPSSQRAGEDAHEALLTLEVPSALLLSSVRPSGTCQANNETILCELGNPFKRNQRMELLI
AFEVIGVTLHTRDLPVLLQLSTSSHQDNLQPVLLTLQVDYTLQASLSLMNHRLQSFFGGT
VMGEAAMKTAEDVGSPLKYEFQVSPVGDGLAALGTLVLGLEWPYEVTNGKWLLYPTEITI
HSNGSWPCQPSGNLVNPLNLTLSDPGVTPLSPQRRRRQLDPGGDQSSPPVTLAAAKKAKS
ETVLTCSNGRARCVWLECPLPDTSNITNVTVKARVWNSTFIEDYKDFDRVRVDGWATLFL
RTSIPTINMENKTTWFSVDIDSELVEELPAEIELWLVLVAVGAGLLLLGLIILLLWKCGF
FKRARTRALYEAKRQKAEMKSQPSETERLTDDY
NT seq 3162 nt NT seq  +upstreamnt  +downstreamnt
atgggccccggcccctgccgcgtgccccgcgcccctggctggctgctccgcgctctggcc
ttgatggtggcggcttgcggccgggtcgccttcgccttcaacctggacacccgattcctg
gtggtgaaggaggcggtgaaccccggtagcctcttcggctactcggtcgccctccatcgg
cagactgagcgacaacagcgctacctccttctggccggggctccccgggacctcgctgtg
ggtgatgactataccaaccggactggtgctgtgtacctgtgtcccctcacggcccacaag
gacgactgtgaacggatggacatttcagagaaaagtgaccctgaccatcacattattgag
gatatgtggcttggagtgactgtggccagccagggccctgcaggtagagtcctggtctgt
gcccatcggtacaccaaggtgctgtggtctgggctagaagaccagcggcgcatggtgggc
aagtgctatgtgcgtggcaatgacctacagctcgaccccggcgatgactggcagacatac
cacaacgagatgtgtaacagcaacactgactacttgcagaccggcatgtgccagctgggc
accagcggcggcttcacccagaacaccgtatacttcggtgcccctggtgcctacaactgg
aaaggaaacagctacatgattcagcggaaggactgggatttatctgaatatagctacagg
ggctcagaggagcaaggaaacctttatattgggtacacggtgcaggtaggcaacgccatc
ctacatcccacggacatcatcactgttgtgacgggtgccccacggcaccaacatatgggc
gctgtcttcttgctgaagcaagagtcaggtggagacctgcagaggaagcaggtgctgaag
ggcacgcaggtgggcgcttattttggcagtgccattgccctggcagacctgaacaatgat
gggtggcaggacctcctggtgggtgctccctactacttcgaacggaaagaggaggtaggg
ggtgccgtctatgtcttcatgaaccaggcgggcgcatccttccctgatcaaccttccctc
ctgcttcacggccccagccgctctgcctttggcatctctatagccagcatcggtgacatc
aaccaggatggattccaggacatcgctgtgggagccccatttgagggcttgggcaaagtc
tacatctaccacagcagctccggggggctcctcaggcagccccagcagataatccatgga
gagaaactcggactgccaggcttggccaccttcggctactccctgagcgggaagatggat
gtggatgaaaacctttacccagacctgctagtagggagcctgtcggaccacatcgtgctg
ctgcgggcccggcctgtcatcaatatcctccataggaccttggtggccaggccagctgtg
ttggaccctgcgctttgtacagctacctcctgtgttcaggtggagctgtgttttgcctac
aaccagagcgctgggaaccccaactacaggcggaacatcaccctggcttacacactggag
gctgacagggaccgacgcccacccaggctccgatttgcccgcagccagtcatctgtcttc
cacggcttcttctccatgccagagacacattgccagacactggagttactgctgatggac
aatgttcgcgataaactccgtcctatcgtcattgccatgaactactccttacctctgcgc
atgcctgatcgcctcaagctcggcttgcggtctctggatgcctacccagtcctcaaccag
gcacaggctatggagaatcacactgaggtccacttccagaaagagtgcgggccagacaac
aagtgcgacagcaacctgcagatgcgagcagccttcctgtctgagcagctgcagcctcta
agcaggctccagtacagcagagacactaagaaactgtttttgagcatcaatgtgaccaat
tcaccgagcagccaacgggctggggaagatgcgcatgaggcattgctcaccctagaggtg
ccatccgccctgctactgtcctccgtgcgcccgtctgggacctgccaagctaataacgag
accatcctgtgtgagctaggaaaccccttcaaacggaaccagaggatggagctgctcatt
gcctttgaggtcatcggggtaacgttgcacacgagggacctcccagtacttcttcagctg
tccacgtcgagtcaccaggacaacttgcagcccgtactcctgactttgcaggtggactac
accctccaggcctcgctcagcttaatgaatcatcggttgcagagcttctttggtggcaca
gtgatgggtgaggctgccatgaaaactgcggaggatgtgggaagtcccctgaaatatgaa
ttccaggtgagcccagtgggagatgggctggcagccttgggcacactggttctaggtctg
gagtggccctatgaagttaccaatggcaagtggctgctgtaccccacggagatcaccatc
catagcaatggttcctggccctgccagccgtctggaaaccttgtcaaccctctcaacctt
actctctctgaccctggagtcacaccactgtcgccacagcgccgccggcggcaactggat
ccagggggagaccagagttccccgcctgtcacactagctgctgccaaaaaagccaagtct
gagactgtgttgacctgctccaatggccgtgcccgctgtgtgtggctggagtgccccctt
ccagacacctccaacattaccaatgtgaccgtgaaagcacgggtgtggaacagcaccttc
attgaggactacaaagactttgacagagtcagggtagatggctgggctaccctgttcctg
agaaccagcatccctaccatcaacatggagaacaagaccacatggttctctgtggacatt
gactcagagctggtggaggagctgccggctgagattgagctgtggttggtgcttgtggcc
gtgggtgctgggttgctgctgctggggctcatcatcctcctcttgtggaagtgcggcttc
ttcaagcgagcccgcactcgtgccctgtatgaagctaagaggcagaaggctgagatgaag
agccagccgtcagagacagaaaggctgaccgacgactactga

KEGG   Mus musculus (mouse): 16403Help
Entry
16403             CDS       T01002                                 

Gene name
Itga6, 5033401O05Rik, AI115430, Cd49f, VLA-6
Definition
(RefSeq) integrin alpha 6
  KO
K06485  integrin alpha 6
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu04514  Cell adhesion molecules (CAMs)
mmu04640  Hematopoietic cell lineage
mmu04810  Regulation of actin cytoskeleton
mmu05145  Toxoplasmosis
mmu05165  Human papillomavirus infection
mmu05200  Pathways in cancer
mmu05222  Small cell lung cancer
mmu05410  Hypertrophic cardiomyopathy (HCM)
mmu05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
mmu05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    16403 (Itga6)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    16403 (Itga6)
   04514 Cell adhesion molecules (CAMs)
    16403 (Itga6)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    16403 (Itga6)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    16403 (Itga6)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    16403 (Itga6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    16403 (Itga6)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    16403 (Itga6)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    16403 (Itga6)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    16403 (Itga6)
   05414 Dilated cardiomyopathy (DCM)
    16403 (Itga6)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    16403 (Itga6)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    16403 (Itga6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    16403 (Itga6)
   04515 Cell adhesion molecules [BR:mmu04515]
    16403 (Itga6)
   04090 CD molecules [BR:mmu04090]
    16403 (Itga6)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   16403 (Itga6)
  Exosomal proteins of breast milk
   16403 (Itga6)
Cell adhesion molecules [BR:mmu04515]
 Integrins
  Integrin alpha subunits
   16403 (Itga6)
CD molecules [BR:mmu04090]
 Proteins
  16403 (Itga6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS LRR19-TM DUF4381 Integrin_alpha
Motif
Other DBs
NCBI-GeneID: 16403
NCBI-ProteinID: NP_001264899
MGI: 96605
Ensembl: ENSMUSG00000027111
Vega: OTTMUSG00000013266
UniProt: Q61739 Q6PEE8
LinkDB All DBs
Position
2 C2-C3; 2 42.79 cM
AA seq 1091 aa AA seqDB search
MAVAGQLCLLYLSAGLLARLGTAFNLDTREDNVIRKSGDPGSLFGFSLAMHWQLQPEDKR
LLLVGAPRAEALPLQRANRTGGLYSCDITSRGPCTRIEFDNDADPMSESKEDQWMGVTVQ
SQGPGGKVVTCAHRYEKRQHVNTKQESRDIFGRCYVLSQNLRIEDDMDGGDWSFCDGRLR
GHEKFGSCQQGVAATFTKDFHYIVFGAPGTYNWKGIVRVEQKNNTFFDMNIFEDGPYEVG
GETDHDESLVPVPANSYLGFSLDSGKGIVSKDDITFVSGAPRANHSGAVVLLKRDMKSAH
LLPEYIFDGEGLASSFGYDVAVVDLNADGWQDIVIGAPQYFDRDGEVGGAVYVYINQQGK
WSNVKPIRLNGTKDSMFGISVKNIGDINQDGYPDIAVGAPYDDLGKVFIYHGSPTGIITK
PTQVLEGTSPYFGYSIAGNMDLDRNSYPDLAVGSLSDSVTIFRSRPVINILKTITVTPNR
IDLRQKSMCGSPSGICLKVKACFEYTAKPSGYNPPISILGILEAEKERRKSGLSSRVQFR
NQGSEPKYTQELTLNRQKQRACMEETLWLQENIRDKLRPIPITASVEIQEPSSRRRVNSL
PEVLPILNSNEAKTVQTDVHFLKEGCGDDNVCNSNLKLEYKFGTREGNQDKFSYLPIQKG
IPELVLKDQKDIALEITVTNSPSDPRNPRKDGDDAHEAKLIATFPDTLTYSAYRELRAFP
EKQLSCVANQNGSQADCELGNPFKRNSSVTFYLILSTTEVTFDTTDLDINLKLETTSNQD
NLAPITAKAKVVIELLLSVSGVAKPSQVYFGGTVVGEQAMKSEDEVGSLIEYEFRVINLG
KPLKNLGTATLNIQWPKEISNGKWLLYLMKVESKGLEQIVCEPHNEINYLKLKESHNSRK
KRELPEKQIDDSRKFSLFPERKYQTLNCSVNVRCVNIRCPLRGLDSKASLVLRSRLWNST
FLEEYSKLNYLDILLRASIDVTAAAQNIKLPHAGTQVRVTVFPSKTVAQYSGVAWWIILL
AVLAGILMLALLVFLLWKCGFFKRSRYDDSIPRYHAVRIRKEEREIKDEKHMDNLEKKQW
ITKWNENESYS
NT seq 3276 nt NT seq  +upstreamnt  +downstreamnt
atggcggtcgcgggccagttgtgcctgctctacctgtccgcggggcttctagcccggctg
ggtacagccttcaacctggacacccgcgaggacaacgtgatccggaaatcgggggatccc
gggagcctcttcggcttctcgctcgccatgcactggcagttgcagccggaggacaagcgg
ctgttgcttgtgggggcacctcgggcagaagcactcccgctgcagagggcgaacagaaca
gggggcctgtacagctgtgacatcacctcccggggaccttgtacacggattgaatttgat
aatgacgctgatcctatgtcagaaagcaaggaagaccagtggatgggagtcactgttcag
agccaaggtccagggggcaaagtggtgacgtgtgcacatcgatatgagaaacggcagcac
gtcaacacgaagcaggagtcgcgggatatctttggaagatgttatgtcctaagtcagaat
ctcagaattgaagatgatatggacggaggagactggagtttctgcgatggccggttgaga
ggccatgaaaagtttggctcctgtcagcaaggagtagcggctactttcactaaggacttt
cattacattgtttttggagccccagggacttacaactggaaagggatcgtccgtgtagaa
caaaagaataacactttttttgacatgaacatctttgaagatgggccctatgaagttggt
ggagagactgatcatgatgaaagtctcgtgcccgttcctgctaacagttacctaggcttt
tcactggactcagggaagggtattgtttctaaagatgacatcacttttgtgtctggtgct
ccaagagccaatcacagtggggctgtagttttgctaaaaagagacatgaagtccgcgcat
ctgctccctgagtatatatttgacggagaaggcctggcttcctcgtttggctatgatgtg
gcagtggtggacctcaatgcagatgggtggcaagacattgttatcggagctccacagtat
tttgatagggatggtgaagtcgggggtgcagtttacgtctacattaaccagcaaggcaaa
tggagtaatgtgaagccgattcgtctaaatgggaccaaagactcgatgtttggaatctct
gtgaaaaatataggtgatattaaccaagatggctatccagatattgctgttggagctccc
tatgatgatctggggaaggtttttatctatcatggatccccgactggcataattaccaag
ccaacacaggttctcgaggggacatcgccttacttcggctattcaatcgctgggaatatg
gacctggatcggaattcctaccccgaccttgctgtgggctccctctcagactcggtcact
attttcagatcccggccagtgattaacattctaaaaaccatcacagtgactcctaacaga
attgacctccgccagaagtccatgtgtggctcacctagcgggatatgcctcaaggttaaa
gcctgttttgaatatactgcgaaaccttccggttataaccctccaatatcaattttgggt
attctcgaagctgaaaaagaaagaagaaagtcagggttgtcatcgagagttcagtttcga
aaccaaggttccgagccaaagtatactcaggagctgaccctgaatcggcagaagcagcgg
gcgtgcatggaggagaccctctggctgcaggagaacatcagagacaagctgcgtcccatc
cccatcacggcttctgtggagatccaggagcccagctctcgccggcgggtgaactcactc
cccgaagttcttcccatcctgaattcaaatgaagccaaaacggtccagacagatgtccac
ttcttaaaggaaggatgtggagacgacaatgtctgtaacagcaaccttaagctagagtat
aaatttggtacccgagaaggaaatcaagacaaattctcttaccttccaattcaaaaaggc
atcccagaattagtcctaaaagatcagaaagatatagctctggaaataacggtgaccaac
agcccttcggatccaaggaatccccggaaagatggcgacgatgcccatgaagccaaactc
atcgccacgtttccagacactctgacatattccgcttacagagaactgagggctttccct
gagaagcagctgagctgtgtggccaaccagaatggctcccaagccgactgtgagctcgga
aatcctttcaagagaaattccagtgttactttctatctgattttaagtacaaccgaggtc
acctttgacaccacagatctggatattaatctgaagttggaaacaacaagcaatcaggat
aatttggctccaattacagcgaaggcaaaagtggttattgaattgcttttatcggtctcc
ggagtcgctaagccttcgcaggtgtattttggaggtacagttgttggtgagcaagctatg
aaatctgaagatgaagtaggaagtttaatagagtatgaatttagggtgattaacttaggc
aagcctcttaaaaacctcggcacagcaaccttgaatatacagtggcccaaggagattagc
aatggcaaatggttgctttatttgatgaaagttgaatccaaaggtttggagcagattgtt
tgtgagccacacaatgaaataaactacctgaagctgaaggagtctcacaactcaagaaag
aaacgggaacttcctgaaaaacagatagatgacagcaggaaattttctttatttcctgaa
agaaaataccagactctcaactgcagcgtcaacgtgaggtgtgtgaacatcaggtgccca
ctgcgagggctggacagcaaggcctctctcgttcttcgttccaggttgtggaacagcaca
tttctagaggaatattccaaactgaactacttggacattctcctgagggcttccatagat
gtcaccgctgctgctcagaatatcaagctccctcacgcgggcactcaggttcgagtgacg
gtgtttccctcaaagactgtagctcagtattcaggagtagcttggtggatcatcctcctg
gctgttcttgccgggattctgatgctggctctattagtgtttttactgtggaagtgtgga
ttctttaagcgctctaggtacgatgacagcattccccgataccatgcggtgcggatccgg
aaagaagagcgagagatcaaagatgagaaacacatggataacctcgaaaaaaaacagtgg
atcaccaagtggaatgaaaacgaaagttactcatag

KEGG   Mus musculus (mouse): 16410Help
Entry
16410             CDS       T01002                                 

Gene name
Itgav, 1110004F14Rik, 2610028E01Rik, CD51, D430040G12Rik
Definition
(RefSeq) integrin alpha V
  KO
K06487  integrin alpha V
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04145  Phagosome
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu04514  Cell adhesion molecules (CAMs)
mmu04810  Regulation of actin cytoskeleton
mmu04919  Thyroid hormone signaling pathway
mmu05163  Human cytomegalovirus infection
mmu05165  Human papillomavirus infection
mmu05200  Pathways in cancer
mmu05205  Proteoglycans in cancer
mmu05222  Small cell lung cancer
mmu05410  Hypertrophic cardiomyopathy (HCM)
mmu05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
mmu05414  Dilated cardiomyopathy (DCM)
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    16410 (Itgav)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    16410 (Itgav)
   04514 Cell adhesion molecules (CAMs)
    16410 (Itgav)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    16410 (Itgav)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    16410 (Itgav)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    16410 (Itgav)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    16410 (Itgav)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    16410 (Itgav)
   05205 Proteoglycans in cancer
    16410 (Itgav)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    16410 (Itgav)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    16410 (Itgav)
   05410 Hypertrophic cardiomyopathy (HCM)
    16410 (Itgav)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    16410 (Itgav)
   05414 Dilated cardiomyopathy (DCM)
    16410 (Itgav)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    16410 (Itgav)
   05165 Human papillomavirus infection
    16410 (Itgav)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    16410 (Itgav)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    16410 (Itgav)
   04515 Cell adhesion molecules [BR:mmu04515]
    16410 (Itgav)
   04090 CD molecules [BR:mmu04090]
    16410 (Itgav)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    16410 (Itgav)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   16410 (Itgav)
  Exosomal proteins of epithelial cells
   16410 (Itgav)
Cell adhesion molecules [BR:mmu04515]
 Integrins
  Integrin alpha subunits
   16410 (Itgav)
CD molecules [BR:mmu04090]
 Proteins
  16410 (Itgav)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS Integrin_alpha LYRIC
Motif
Other DBs
NCBI-GeneID: 16410
NCBI-ProteinID: NP_032428
MGI: 96608
Ensembl: ENSMUSG00000027087
Vega: OTTMUSG00000013360
UniProt: P43406
LinkDB All DBs
Position
2 D; 2 49.33 cM
AA seq 1044 aa AA seqDB search
MAAPGRLLLRPRPGGLLLLLPGLLLPLADAFNLDVESPAEYAGPEGSYFGFAVDFFEPST
SSRMFLLVGAPKANTTQPGIVEGGQVLKCECSSSRRCQPIEFDSTGNRDYAKDDPLEFKS
HQWFGASVRSKQDKILACAPLYHWRTEMKQEREPVGTCFLQDGTKTVEYAPCRSKNIDAD
GQGFCQGGFSIDFTKADRVLLGGPGSFYWQGQLISDQVAEIISKYDPNVYSIKYNNQLAT
RTAQAIFDDSYLGYSVAVGDFNGDGIEDFVSGVPRAARTLGMVYIYDGKNMSSLHNFTGE
QMAAYFGFSVAATDINGDDYADVFIGAPLFMDRGSDGKLQEVGQVSVSLQRAVGDFQTTK
LNGFEVFARFGSAIAPLGDLDQDGFNDIAIAAPYGGEDKKGLVYIFNGRSTGLNSVPSQI
LEGQWAAQSMPPSFGYSMKGATDVDRNGYPDLVVGAFGVDRAVLYRARPVVTVNAGLEVY
PSILNQDNKICPLPGTALKVSCFNVRFCLKADGKGTLPRKLHFQVELLLDKLKQKGAIRR
ALFLHNRSPVHSKTMTVFRGGQMQCEELVAYLRDESEFRDKLTPITIFMEYRLDQRTAAD
ATGLQPILNQFTPANVSRQAHILLDCGEDNVCKPKLEVSVNSDQKKIYIGDDNPLTLTVK
AQNQGEGAYEAELIVSIPPQADFIGVVRNNEALARLSCAFKTENQTRQVVCDLGNPMKAG
TQLLAGLRFSVHQQSEMDTSVKFDLKIQSSNSFDNVSPVVSYKVDLAVLAAVEIRGVSSP
DHIFLPIPNWEYKENPETEEDVGPIVQHIYELRNNGPSSFSKAILNLQWPYKYNNNTLLY
ILHYDIDGPMNCTADTEINPLRIKTPEKNDTAAAGQGERNHLITKRDLTLREGDVHTLGC
GIAKCLQITCQVGRLDRGKSAILYVKSLLWTETFMNKENQNHSYSLKSSASFNIIEFPYK
NLPIEDLFNSTLVTTNITWGIQPAPMPVPVWVIILAVLAGLLLLAVLVFVMYRMGFFKRV
RPPQEEQEREQLQPHENGEGNSET
NT seq 3135 nt NT seq  +upstreamnt  +downstreamnt
atggctgctcccgggcgcctgctgctacgccctcgccccggcggcctcctgctgctgctg
ccgggtctcctgctgcccctcgccgacgccttcaacctggacgtcgaaagtcccgccgag
tatgcgggtcccgagggaagttacttcggattcgccgtggacttcttcgagcccagcacg
tcctccaggatgtttctcctggtgggagcccccaaagcgaacacgacccagcctgggatt
gtagaaggagggcaagttctcaaatgtgaatgctcatccagccgccggtgccagcccatt
gagtttgattcaacaggcaatcgagattatgccaaagatgacccactggagtttaagtcc
caccagtggtttggagcctctgtgaggtcaaagcaggataaaatcttggcctgtgctcca
ttgtaccactggaggactgagatgaagcaggagagagagccagttggaacctgctttctt
caggacggcacaaagaccgttgagtatgctccatgcaggtcaaaaaatattgatgctgat
ggccagggattttgtcaaggaggattcagcattgattttactaaagctgacagagtactt
ctcggtggtcctggtagcttttattggcaaggtcagctcatttcggaccaagtggcagaa
atcatatctaaatatgacccaaatgtctacagcatcaaatataataaccaattagcaaca
cggactgcacaagcaatttttgatgacagttatttgggttactctgtggccgtgggagac
ttcaatggtgacggcattgaagattttgtctcaggagttccaagagcagcaaggactttg
ggaatggtttatatttatgatgggaaaaatatgtcctctttacacaattttactggtgaa
cagatggctgcgtattttggattttctgtagctgctactgacattaatggggatgattac
gcagatgtgtttattggagcccccctgttcatggaccgaggttccgatgggaaactccag
gaggttggccaggtctcagtgtctctgcagagagcagtgggagacttccagactacaaag
ctgaacggctttgaggtttttgccaggtttggaagtgccatagctccattgggagacctg
gaccaggatggcttcaatgatattgcaattgctgctccctatggtggtgaagataagaag
ggacttgtttatatcttcaatggaaggtccacaggcttgaattcggtgccatctcaaatc
ctcgaggggcagtgggctgctcagagcatgcccccaagctttggctattcaatgaaggga
gctacagatgtagacaggaatggatatccagacttagttgtaggagcttttggtgtggat
cgagctgtcttatacagagccagacccgttgtcactgtaaatgctggccttgaagtgtac
cctagcattttaaatcaagacaataagatctgcccgttgcctgggacagctctcaaggtt
tcctgttttaatgtcagattctgcttaaaggcagatggcaagggaacccttcctcggaag
ctccacttccaggtggagcttctactggataaactcaagcagaagggagccatccgacga
gcactgtttctccataacaggtccccggtccactccaagaccatgactgttttcaggggg
ggacagatgcagtgtgaggaactggtcgcctatcttcgggatgaatctgaatttagagac
aagctcactcccatcaccattttcatggagtatcggttggaccagagaacggctgctgat
gccacaggcttgcagcccatcctgaaccagttcactccggccaacgtcagtcggcaggct
catattctacttgactgtggtgaagacaatgtctgtaaacctaaattggaagtttctgta
aatagtgatcaaaagaagatctatattggggacgacaaccctctgacactgactgtgaag
gcgcagaatcaaggggaaggcgcctatgaagctgagctcatcgtttctatcccaccgcag
gctgacttcatcggggttgtccggaacaacgaagccttagcaagactgtcctgtgcattt
aagacagaaaaccaaactcggcaggtggtgtgcgaccttggaaacccgatgaaggctgga
actcaactgctcgctggtcttcgtttcagcgtgcaccagcagtcagagatggatacttct
gtgaagtttgacttgaaaatccagagctctaattcttttgacaatgtaagtccagttgtg
tcttacaaggttgacctcgccgttttggctgctgtggagataagaggagtttcaagtcca
gatcatatctttcttccaattccaaattgggagtacaaggaaaaccctgagactgaagaa
gacgttgggcctattgttcagcacatatatgagctgagaaacaatggtccaagttcattc
agcaaggcaattctaaatctccagtggccttacaaatacaacaacaacactctgttgtac
attcttcattacgacattgacgggccaatgaactgcacggcagatacagagatcaaccct
ttgagaatcaagacacccgaaaagaatgacacagcggcggcgggacagggagaaaggaat
catctcatcaccaagcgggatctcaccctcagagagggagatgttcacactttgggctgt
ggaatcgccaagtgcttgcagatcacctgccaggttggtcgactggatagaggcaagagc
gcaatcctgtacgtgaaatccctgctgtggaccgagacgttcatgaacaaggagaaccag
aaccattcctattcgctgaagtcatctgcttcctttaatatcatagaattcccttacaag
aacctgccgatcgaggatctcttcaactctacactagtcaccactaacatcacctggggc
attcagccggcgcccatgcctgtgcctgtgtgggtgatcatcttggcagttctcgcaggg
ctgctgctactggctgtgttggtatttgtaatgtacaggatgggctttttcaaacgtgtc
cgaccacctcaagaagagcaagaaagagaacagcttcagcctcatgagaatggcgaagga
aactctgaaacctaa

DBGET integrated database retrieval system