KEGG   Mus musculus (mouse): 16412Help
Entry
16412             CDS       T01002                                 

Gene name
Itgb1, 4633401G24Rik, AA409975, AA960159, CD29, Fnrb, Gm9863, gpIIa
Definition
(RefSeq) integrin beta 1 (fibronectin receptor beta)
  KO
K05719  integrin beta 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04015  Rap1 signaling pathway
mmu04145  Phagosome
mmu04151  PI3K-Akt signaling pathway
mmu04360  Axon guidance
mmu04510  Focal adhesion
mmu04512  ECM-receptor interaction
mmu04514  Cell adhesion molecules (CAMs)
mmu04530  Tight junction
mmu04611  Platelet activation
mmu04670  Leukocyte transendothelial migration
mmu04810  Regulation of actin cytoskeleton
mmu05100  Bacterial invasion of epithelial cells
mmu05133  Pertussis
mmu05135  Yersinia infection
mmu05140  Leishmaniasis
mmu05145  Toxoplasmosis
mmu05165  Human papillomavirus infection
mmu05200  Pathways in cancer
mmu05205  Proteoglycans in cancer
mmu05222  Small cell lung cancer
mmu05410  Hypertrophic cardiomyopathy (HCM)
mmu05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
mmu05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    16412 (Itgb1)
   04151 PI3K-Akt signaling pathway
    16412 (Itgb1)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    16412 (Itgb1)
   04514 Cell adhesion molecules (CAMs)
    16412 (Itgb1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    16412 (Itgb1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    16412 (Itgb1)
   04530 Tight junction
    16412 (Itgb1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    16412 (Itgb1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    16412 (Itgb1)
   04670 Leukocyte transendothelial migration
    16412 (Itgb1)
  09158 Development
   04360 Axon guidance
    16412 (Itgb1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    16412 (Itgb1)
   05205 Proteoglycans in cancer
    16412 (Itgb1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    16412 (Itgb1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    16412 (Itgb1)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    16412 (Itgb1)
   05414 Dilated cardiomyopathy (DCM)
    16412 (Itgb1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    16412 (Itgb1)
   05133 Pertussis
    16412 (Itgb1)
   05100 Bacterial invasion of epithelial cells
    16412 (Itgb1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    16412 (Itgb1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    16412 (Itgb1)
   05140 Leishmaniasis
    16412 (Itgb1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    16412 (Itgb1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    16412 (Itgb1)
   04515 Cell adhesion molecules [BR:mmu04515]
    16412 (Itgb1)
   04090 CD molecules [BR:mmu04090]
    16412 (Itgb1)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    16412 (Itgb1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Proteins found in most exosomes
   16412 (Itgb1)
Cell adhesion molecules [BR:mmu04515]
 Integrins
  Integrin beta subunits
   16412 (Itgb1)
CD molecules [BR:mmu04090]
 Proteins
  16412 (Itgb1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Integrin_beta Integrin_b_cyt Integrin_B_tail I-EGF_1 PSI_integrin EGF_2
Motif
Other DBs
NCBI-GeneID: 16412
NCBI-ProteinID: NP_034708
MGI: 96610
Ensembl: ENSMUSG00000025809
Vega: OTTMUSG00000034034
UniProt: P09055
LinkDB All DBs
Position
8; 8 E2
AA seq 798 aa AA seqDB search
MNLQLVSWIGLISLICSVFGQTDKNRCLKANAKSCGECIQAGPNCGWCTNTTFLQEGMPT
SARCDDLEALKKKGCQPSDIENPRGSQTIKKNKNVTNRSKGMAEKLRPEDITQIQPQQLL
LKLRSGEPQKFTLKFKRAEDYPIDLYYLMDLSYSMKDDLENVKSLGTDLMNEMRRITSDF
RIGFGSFVEKTVMPYISTTPAKLRNPCTSEQNCTSPFSYKNVLSLTDRGEFFNELVGQQR
ISGNLDSPEGGFDAIMQVAVCGSLIGWRNVTRLLVFSTDAGFHFAGDGKLGGIVLPNDGQ
CHLENNVYTMSHYYDYPSIAHLVQKLSENNIQTIFAVTEEFQPVYKELKNLIPKSAVGTL
SGNSSNVIQLIIDAYNSLSSEVILENSKLPDGVTINYKSYCKNGVNGTGENGRKCSNISI
GDEVQFEISITANKCPNKESETIKIKPLGFTEEVEVVLQFICKCNCQSHGIPASPKCHEG
NGTFECGACRCNEGRVGRHCECSTDEVNSEDMDAYCRKENSSEICSNNGECVCGQCVCRK
RDNTNEIYSGKFCECDNFNCDRSNGLICGGNGVCRCRVCECYPNYTGSACDCSLDTGPCL
ASNGQICNGRGICECGACKCTDPKFQGPTCETCQTCLGVCAEHKECVQCRAFNKGEKKDT
CAQECSHFNLTKVESREKLPQPVQVDPVTHCKEKDIDDCWFYFTYSVNGNNEAIVHVVET
PDCPTGPDIIPIVAGVVAGIVLIGLALLLIWKLLMIIHDRREFAKFEKEKMNAKWDTGEN
PIYKSAVTTVVNPKYEGK
NT seq 2397 nt NT seq  +upstreamnt  +downstreamnt
atgaatttgcaactggtttcctggattggattgatcagtttgatttgttctgtatttggc
caaacagataaaaatagatgtttaaaagcaaatgccaaatcttgcggagaatgtatacaa
gcagggccaaattgtgggtggtgtacaaatacgacatttttgcaagaaggaatgcctact
tctgcacgatgtgatgatttagaagctttgaaaaagaagggttgccagccaagtgacata
gagaatcccagaggctctcaaactataaagaaaaataaaaatgtcaccaatcgcagcaaa
gggatggcagagaagctccggccagaagacattactcagatccaaccacaacagctgctt
ctaaaattgagatcaggagaaccacagaagtttacattaaaattcaagagggctgaagat
taccctattgatctctactaccttatggatctctcctactctatgaaagatgatctggag
aatgtgaaaagtcttggaacggatttgatgaatgaaatgaggaggattacttcagacttc
cgcattggctttggctcatttgtggagaaaactgtgatgccgtatattagcacaacccca
gcaaagctaagaaatccttgtacaagtgaacaaaactgcaccagcccatttagctacaaa
aatgtgcttagtcttactgacagaggagagtttttcaatgaacttgttggtcagcaacgc
atatctggaaacttggattctccagaaggtggctttgatgcaatcatgcaggttgcggtt
tgtggatcgctgattggctggaggaatgtaacacgactgctggtgttttccacggatgct
gggtttcactttgctggagatgggaaacttggtggtattgttttacccaatgatggacaa
tgtcacctggaaaataatgtatatacaatgagccattactatgattatccttcaattgct
caccttgttcagaaactaagtgaaaataatattcagacgatttttgcagttactgaagag
ttccaacctgtttacaaggaattgaagaatttgattcctaagtcagcagtgggcacactg
tctggaaactctagtaatgtgatccagctaatcatcgatgcctacaactctctttcttca
gaagtcattctggaaaatagcaaattgccagacggagtaacaataaattacaaatcctat
tgcaagaatggggtgaatgggacaggagaaaatggacgaaagtgttccaacatttctatt
ggagatgaggttcaatttgaaattagcataactgctaataaatgtccaaataaggagtct
gaaaccattaaaattaaacctctgggcttcactgaagaagtagaggtcgttcttcagttc
atctgtaagtgcaattgtcaaagccatggcatcccagccagtcccaagtgccatgaggga
aatgggacatttgagtgtggagcctgcaggtgcaatgaggggcgtgttgggaggcactgt
gaatgtagcacagatgaagtgaacagtgaagacatggacgcttactgcaggaaagagaac
agttcggaaatctgcagtaacaatggagaatgtgtctgtggacagtgtgtgtgtaggaag
agagataatacaaatgaaatttactctggaaaattctgcgagtgtgataacttcaactgt
gataggtctaatggcttaatttgtggaggcaatggcgtgtgcaggtgtcgtgtttgtgaa
tgctatcccaattacactggcagtgcatgtgactgttctttggacactggtccatgtcta
gcgtcaaatggtcagatctgcaatggccggggtatttgtgaatgtggtgcttgtaagtgc
acagatcccaagtttcaagggccaacttgtgagacatgtcagacctgccttggcgtctgt
gcagagcataaagaatgtgttcagtgcagagccttcaataaaggagaaaagaaagacacg
tgtgcacaggagtgctcccacttcaatctcaccaaagtagaaagcagggagaagttgccc
cagccggtgcaggtcgatcctgtgacccattgcaaggagaaggacattgatgactgctgg
ttctatttcacctattcagtgaatggcaacaatgaagctatcgtgcatgttgtggagact
ccagactgtcctactggtcccgacatcatcccaattgtagcaggcgtggttgctggaatt
gttcttattggccttgccttgctgctgatttggaaacttttaatgataattcatgacaga
agggaatttgctaaatttgaaaaggagaaaatgaatgccaagtgggacacgggtgaaaat
cctatttacaagagtgccgtgacaactgtggtcaatccgaagtatgagggaaaatga

DBGET integrated database retrieval system