KEGG   Mus musculus (mouse): 16451Help
Entry
16451             CDS       T01002                                 

Gene name
Jak1, AA960307, BAP004, C130039L05Rik
Definition
(RefSeq) Janus kinase 1
  KO
K11217  Janus kinase 1 [EC:2.7.10.2]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01521  EGFR tyrosine kinase inhibitor resistance
mmu04151  PI3K-Akt signaling pathway
mmu04217  Necroptosis
mmu04380  Osteoclast differentiation
mmu04550  Signaling pathways regulating pluripotency of stem cells
mmu04621  NOD-like receptor signaling pathway
mmu04630  Jak-STAT signaling pathway
mmu04658  Th1 and Th2 cell differentiation
mmu04659  Th17 cell differentiation
mmu05140  Leishmaniasis
mmu05145  Toxoplasmosis
mmu05152  Tuberculosis
mmu05160  Hepatitis C
mmu05161  Hepatitis B
mmu05162  Measles
mmu05163  Human cytomegalovirus infection
mmu05164  Influenza A
mmu05165  Human papillomavirus infection
mmu05166  Human T-cell leukemia virus 1 infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05200  Pathways in cancer
mmu05203  Viral carcinogenesis
mmu05212  Pancreatic cancer
mmu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    16451 (Jak1)
   04151 PI3K-Akt signaling pathway
    16451 (Jak1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    16451 (Jak1)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    16451 (Jak1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    16451 (Jak1)
   04658 Th1 and Th2 cell differentiation
    16451 (Jak1)
   04659 Th17 cell differentiation
    16451 (Jak1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    16451 (Jak1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    16451 (Jak1)
   05203 Viral carcinogenesis
    16451 (Jak1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    16451 (Jak1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    16451 (Jak1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    16451 (Jak1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    16451 (Jak1)
   05162 Measles
    16451 (Jak1)
   05164 Influenza A
    16451 (Jak1)
   05161 Hepatitis B
    16451 (Jak1)
   05160 Hepatitis C
    16451 (Jak1)
   05168 Herpes simplex virus 1 infection
    16451 (Jak1)
   05163 Human cytomegalovirus infection
    16451 (Jak1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    16451 (Jak1)
   05169 Epstein-Barr virus infection
    16451 (Jak1)
   05165 Human papillomavirus infection
    16451 (Jak1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    16451 (Jak1)
   05140 Leishmaniasis
    16451 (Jak1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    16451 (Jak1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    16451 (Jak1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     16451 (Jak1)
Protein kinases [BR:mmu01001]
 Non-receptor tyrosine kinases
  JAK family [OT]
   16451 (Jak1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase FERM_F2 Jak1_Phl FERM_F1 RIO1 SH2 FERM_M
Motif
Other DBs
NCBI-GeneID: 16451
NCBI-ProteinID: NP_038595
MGI: 96628
Ensembl: ENSMUSG00000028530
Vega: OTTMUSG00000008208
LinkDB All DBs
Position
4 C6; 4 46.19 cM
AA seq 1052 aa AA seqDB search
MQYLNIKEDCNAMAFCAKMRSFKKTEVKQVVPEPGVEVTFYLLDREPLRLGSGEYTAEEL
CIRAAQECSISPLCHNLFALYDESTKLWYAPNRIITVDDKTSLRLHYRMRFYFTNWHGTN
DNEQSVWRHSPKKQKNGYEKKRVPEATPLLDASSLEYLFAQGQYDLIKCLAPIRDPKTEQ
DGHDIENECLGMAVLAISHYAMMKKMQLPELPKDISYKRYIPETLNKSIRQRNLLTRMRI
NNVFKDFLKEFNNKTICDSSVSTHDLKVKYLATLETLTKHYGAEIFETSMLLISSENELS
RCHSNDSGNVLYEVMVTGNLGIQWRQKPNVVPVEKEKNKLKRKKLEYNKHKKDDERNKLR
EEWNNFSYFPEITHIVIKESVVSINKQDNKNMELKLSSREEALSFVSLVDGYFRLTADAH
HYLCTDVAPPLIVHNIQNGCHGPICTEYAINKLRQEGSEEGMYVLRWSCTDFDNILMTVT
CFEKSEVLGGQKQFKNFQIEVQKGRYSLHGSMDHFPSLRDLMNHLKKQILRTDNISFVLK
RCCQPKPREISNLLVATKKAQEWQPVYSMSQLSFDRILKKDIIQGEHLGRGTRTHIYSGT
LLDYKDEEGIAEEKKIKVILKVLDPSHRDISLAFFEAASMMRQVSHKHIVYLYGVCVRDV
ENIMVEEFVEGGPLDLFMHRKSDALTTPWKFKVAKQLASALSYLEDKDLVHGNVCTKNLL
LAREGIDSDIGPFIKLSDPGIPVSVLTRQDPDIVSEKQPTTEVDPTHFEKRFLKRIRDLG
EGHFGKVELCRYDPEGDNTGEQVAVKSLKPESGGNHIADLKKEIEILRNLYHENIVKYKG
ICMEDGGNGIKLIMEFLPSGSLKEYLPKNKNKINLKQQLKYAIQICKGMDYLGSRQYVHR
DLAARNVLVESEHQVKIGDFGLTKAIETDKEYYTVKDDRDSPVFWYAPECLIQCKFYIAS
DVWSFGVTLHELLTYCDSDFSPMALFLKMIGPTHGQMTVTRLVNTLKEGKRLPCPPNCPD
EVYQLMRKCWEFQPSNRTTFQNLIEGFEALLK
NT seq 3159 nt NT seq  +upstreamnt  +downstreamnt
atgcagtatctaaatataaaagaggactgcaatgccatggcgttctgtgctaaaatgagg
agcttcaagaagactgaggtgaagcaggtggtccctgagcctggagtggaggtgactttc
tatctgttggacagggagcccctccgcctgggcagcggagagtatacagccgaggagctg
tgcatcagggccgcccaggagtgcagtatctctcctctctgtcacaacctcttcgccctg
tacgatgagagcaccaagctctggtacgctccgaaccgaatcatcactgtggatgacaaa
acgtctctccggctccactaccgcatgaggttctactttaccaactggcacggaaccaat
gacaacgaacagtctgtatggcgacattctccaaagaagcagaaaaacggctatgagaag
aaaagggttccagaagcaaccccactccttgatgccagttcactggagtatctgtttgca
cagggacagtatgatttgatcaaatgcctggctcccattcgggaccccaagacggagcaa
gacggacatgatattgaaaatgagtgcctgggcatggcggtcctggccatctcccactat
gccatgatgaagaagatgcagttgccggaacttcccaaagacatcagctacaagcgatat
attccagaaacattgaataaatccatcagacagaggaaccttcttaccaggatgcgaata
aataatgttttcaaggatttcttgaaggaatttaacaacaagaccatctgtgacagcagt
gtgtctacacatgacctgaaggtgaaatacctggctaccttggaaactttgacaaaacat
tatggagctgaaatatttgagacttctatgctactgatttcatcagaaaatgaattgagt
cgatgccattcgaatgacagtggcaatgttctctatgaggtcatggtgactggaaatctc
gggatccagtggcggcagaaaccaaatgttgttcctgttgaaaaggaaaaaaataaactg
aagcggaaaaaactggaatataataaacacaagaaggatgatgagagaaacaaactccgg
gaagagtggaacaatttttcctatttccctgaaatcacccacattgtaataaaggagtct
gtggtcagcattaacaaacaggacaacaaaaacatggaactcaagctctcttctcgagag
gaagccttgtcctttgtgtccctggtggatggctacttccggctcactgcagatgcccac
cattacctctgtactgatgtggctcccccactgattgtccacaatatacagaacggctgc
cacggtccaatctgcacagaatatgccatcaataagctgcggcaggaagggagtgaagag
gggatgtacgtgctgaggtggagctgcaccgactttgacaacattcttatgactgtcacc
tgctttgaaaagtctgaggtattgggtggccagaagcagttcaagaactttcagattgag
gtacagaagggccgctacagcctgcatggctctatggaccactttcccagcctgcgagac
ctcatgaaccacctcaagaagcagatcctgcgcacggacaacataagctttgtgctgaaa
cgatgctgtcagcctaagcctcgagaaatctccaatctgctcgtagccactaagaaagcc
caggagtggcagcctgtctactccatgagccagctgagctttgatcggatccttaagaaa
gatattatacaaggtgagcaccttggcagaggcacaagaacacatatctattctgggacc
ctgctggactacaaggatgaggaaggaattgctgaagagaagaagataaaagtgatcctc
aaagtcctagaccccagccaccgggacatctctctggccttctttgaggctgctagcatg
atgagacaggtttcccacaaacatatagtgtacctctacggcgtgtgtgtccgagatgtg
gaaaatatcatggtggaagagtttgtggagggggggccgttggatctcttcatgcaccgg
aaaagtgatgcgcttactaccccctggaagttcaaggttgccaaacagctggccagtgcc
ctgagttacttggaagataaagacctggttcatggaaatgtgtgcactaaaaacctcctt
ctggcccgtgagggcattgacagtgacattggcccgttcatcaagcttagtgaccctggc
atcccagtctctgtgctgaccaggcaagatccagacattgtttcagaaaagcagccaaca
acagaggtggaccccactcactttgaaaagcggttcctgaagaggattcgtgacttggga
gagggtcactttgggaaggttgagctctgcagatatgatcctgagggagacaacacaggg
gagcaggtagctgtcaagtccctgaagcctgagagtggaggtaaccacatagctgatctg
aagaaggagatagagatcttacggaacctctaccatgagaacattgtgaagtacaaagga
atctgcatggaagacggaggcaatggtatcaagctcatcatggagtttctgccttcggga
agcctaaaggagtatctgccaaagaataagaacaaaatcaacctcaaacagcagctaaaa
tatgccatccagatttgtaaggggatggactacttgggttctcggcaatacgttcaccgg
gacttagcagcaagaaatgtccttgttgagagtgagcatcaagtgaagatcggagacttt
ggtttaaccaaagcaattgaaaccgataaggagtactacacagtcaaggacgaccgggac
agcccagtgttctggtacgctccggaatgtttaatccagtgtaaattttatatcgcctct
gatgtctggtcttttggagtgacactgcacgagctgctcacttactgtgactcagatttt
agtcccatggccttgttcctgaaaatgataggcccaactcatggccagatgacagtgaca
cggcttgtgaatactctgaaagaaggaaagcgtctgccatgtccacccaactgtcctgat
gaggtttatcagcttatgagaaaatgctgggaattccaaccatctaaccggacaactttt
cagaaccttattgaaggatttgaagcacttttaaaataa

DBGET integrated database retrieval system