KEGG   Mus musculus (mouse): 16468Help
Entry
16468             CDS       T01002                                 

Gene name
Jarid2, Jmj, jumonji
Definition
(RefSeq) jumonji, AT rich interactive domain 2
  KO
K11478  protein Jumonji
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    16468 (Jarid2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    16468 (Jarid2)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic Type
  Histone modification proteins
   Histone demethylases
    16468 (Jarid2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: JmjC ARID JmjN zf-C5HC2
Motif
Other DBs
NCBI-GeneID: 16468
NCBI-ProteinID: NP_001191972
MGI: 104813
Ensembl: ENSMUSG00000038518
Vega: OTTMUSG00000037582
UniProt: Q62315
LinkDB All DBs
Structure
PDB: 

Position
13 A5; 13 21.66 cM
AA seq 1234 aa AA seqDB search
MSKERPKRNIIQKKYDDSDGIPWSEERVVRKVLYLSLKEFKNAQKRQHGEGLAGSLKAVN
GLLGNAQAKALGPASEQSENEKDDASQVSSTSNDVSSSDFEEGPSRKRPRLQAQRKFAQS
QPNSPSTTPVKIVEPLLPPPATQISDLSKRKPKTEDFLTFLCLRGSPALPNSMVYFGSSQ
DEEDVEEEDDETEDVKATTNNASSSCQSTPRKGKTHKHVHNGHVFNGSSRSAREKEPAHK
HRSKEATPGKEKHSEPRADSRREQASGAQPTAASAAASSAKGLAANHQPPPSHRSAQDLR
KQVSKVNGVTRMSSLGAGTNSAKKIREVRPSPSKTVKYTATVTKGTVTYTKAKRELVKET
KPNHHKPSSAVNHTISGKTESSNAKTRKQVLSLGGASKSTGPAASGLKASSRLNPKSCTK
EVGGRQLREGLRNSKRRLEEAQQVDKPQSPPKKMKGVAGNAEAPGKKASAASGEKSLLNG
HVKKEVPERSLERNRPKRAAAGKNMLGKQAHGKTEGTPCENRSTSQPESSHKPHDPQGKP
EKGSGKSGWAAMDEIPVLRPSAKEFHDPLIYIESVRAQVEKYGMCRVIPPPDWRPECKLN
DEMRFVTQIQHIHKLGRRWGPNVQRLACIKKHLRSQGITMDELPLIGGCELDLACFFRLI
NEMGGMQQVTDLKKWNKLADMLRIPKTAQDRLAKLQEAYCQYLLSYDSLSPEEHRRLEKE
VLMEKEILEKRKGPLEGHTESDHHKFHSLPRFEPKNGLVHGVTPRNGFRSKLKEVGRAPL
KTGRRRLFAQEKEVVKEEEEDKGVLNDFHKCIYKGRSVSLTTFYRTARNIMNMCFSKEPA
PAEIEQEYWRLVEEKDCHVAVHCGKVDTNTHGSGFPVGKSEPFSRHGWNLTVLPNNTGSI
LRHLGAVPGVTIPWLNIGMVFSTSCWSRDQNHLPYIDYLHTGADCIWYCIPAEEENKLED
VVHTLLQGNGTPGLQMLESNVMISPEVLCKKGIKVHRTVQQSGQFVVCFPGSFVSKVCCG
YNVSETVHFATTQWTSMGFETAKEMKRRHIAKPFSMEKLLYQIAQAEAKKENGPTLSTIS
ALLDELRDTELRQRRLLFEAGLHSSARYGSHDGNSTVADGKKKPRKWLQLETSERRCQIC
QHLCYLSMVVQENENVVFCLECALRHVEKQKSCRGLKLMYRYDEEQIISLVNQICGKVSG
KHGGIENCLNKPTPKRGPRKRATVDVPPSRLPSS
NT seq 3705 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaggaaagacccaagaggaatatcattcagaagaaatacgatgacagcgatggg
atcccgtggtcagaagagagagttgtacgaaaagtcctgtatttgtccctaaaggaattc
aagaatgcacagaaaaggcagcatggggaaggccttgccgggagcctgaaggcggtaaat
gggcttcttggtaatgcccaggctaaggcactaggaccagcctcagagcagtcagagaac
gagaaggatgatgcctcccaagtgtcctctactagcaacgatgttagttcttcagatttt
gaagaagggccgtcgaggaaaaggcccaggctgcaagcacaaaggaagtttgctcaatct
cagccgaatagtcccagcacaactccagtgaagatagtggagcctttgctacccccgcca
gctactcaaatttctgacctctctaaaaggaagcctaagacagaagactttcttaccttt
ctctgccttcgaggttctcctgcgctgcccaacagtatggtatattttggaagctctcag
gatgaggaggatgtcgaagaggaagatgatgagacggaagatgtcaaagcaaccaccaac
aatgcttcatcttcgtgccagtcaacccccaggaaaggaaaaacccataagcatgtacac
aacgggcacgttttcaatggctccagtaggtcagcacgggagaaagagcctgctcacaaa
cacagaagcaaagaggccactccggggaaggagaagcacagcgagcccagggcagacagc
cggagagaacaggcttcaggggctcagcccacggccgcctcggctgcggcttcctctgcc
aagggacttgctgccaaccaccaacctcccccttcgcatcggtctgctcaggacttacgg
aaacaggtgtctaaggtaaatggagtcactcgaatgtcatctctgggtgcaggtacaaac
agtgccaaaaagatccgagaagtcagaccttcaccatccaaaactgtgaagtacactgcc
acagtgaccaaggggactgtcacatacaccaaagccaagagagaactggtcaaggaaacc
aaacccaaccaccacaaacccagttcagctgtcaaccacacaatctcagggaaaactgaa
agtagcaatgcaaaaacccgcaaacaggtgctatcccttgggggggcgtccaagtccacc
gggcctgctgccagtggcctcaaggccagcagcaggttgaacccaaagtcatgcactaag
gaggtgggggggcggcagctgagggaggggctgcggaattccaaaaggagactggaagag
gcacagcaagtggacaagccgcagtcaccccccaagaagatgaagggggtggcaggcaat
gctgaagcccctggcaaaaaggcctcagcggcttcaggagaaaagtctctgctgaatgga
cacgtgaagaaggaagtgcccgagcgaagtttggaaaggaatcggccaaagcgggccgcg
gctggcaagaatatgctgggcaaacaagcacatggcaagacagagggcaccccctgtgaa
aatcgttctacctcgcaacccgagtcctcgcacaagccgcatgacccacagggcaagcca
gagaaggggagcggcaagtctgggtgggcagcgatggacgagatccctgtcctcaggccc
tccgccaaggagttccacgacccgctcatctacatcgagtcagtacgtgctcaggtggag
aagtacgggatgtgtcgcgtgattccccctccagactggcggccagagtgcaagctcaac
gatgagatgcgctttgtcacgcagatccagcacatccataagctgggccggcgctggggc
cccaacgtgcagcggctagcctgcataaagaagcacctcagatctcagggcatcaccatg
gatgagctccccctcataggaggctgtgagctcgacctggcctgctttttccggctgatt
aatgagatgggcggcatgcagcaagtgactgacctcaaaaaatggaacaaactagcagac
atgctgcgcattcccaaaactgcccaggaccggctggccaagctgcaggaggcctactgc
cagtacctgctttcctatgactccctgtcccccgaggagcaccgacggctggagaaggag
gtgctgatggagaaggagatcctggaaaagcgcaaagggccattagaggggcacacggag
agcgaccaccacaagttccactccctgccccgctttgagcccaagaatgggctcgtccac
ggtgtcacacctaggaatggattccgtagcaagctcaaggaggtgggccgggccccactg
aagacgggccggcggcggctgttcgctcaggaaaaagaagtggtcaaagaggaggaagaa
gacaaaggtgtcctcaatgacttccacaagtgcatctataagggaagatctgtttctcta
acaactttttatcgaacagcaagaaacatcatgaacatgtgtttcagcaaggagcccgca
ccagcagagattgagcaagagtactggaggttagtggaagagaaggactgtcatgtggca
gttcactgcggaaaggtggacactaatacccatggcagcgggttcccggtgggaaaatca
gaacccttttcaaggcatggatggaacctcactgtcctcccaaataacacagggtccatc
ctgcgtcaccttggtgctgtgcctggagtgactattccctggctaaatattggcatggtc
ttttctacctcatgctggtctcgagaccaaaatcaccttccatatattgactacttacac
actggtgctgactgcatttggtattgcattcctgctgaggaggagaacaagctggaggac
gtagtccacactctgctgcagggcaatggtaccccagggctgcagatgctggagagcaat
gtaatgatctccccagaggtgctgtgcaagaaggggatcaaggtccacaggactgtacag
cagagtgggcagtttgtcgtctgcttcccgggatcctttgtgtccaaagtatgttgtggc
tacaacgtctcagagacagtgcactttgctaccacccagtggacaagcatgggcttcgag
actgccaaggagatgaagcgccgccatatagctaagccattctccatggagaagttgctc
taccagattgcacaagcagaagcaaaaaaggaaaatggtcccaccctcagtaccatctca
gcccttctggatgagctcagggatacagagctgcggcagcgcaggctgttgttcgaggct
ggccttcactcttctgcacgctatggcagccacgacggcaacagcacagtggcggatggg
aagaaaaagcctcgaaagtggctacagctggaaacttcagaaaggaggtgccagatctgc
cagcacttgtgctacctgtccatggtggtacaggagaatgagaatgtcgtgttctgcctg
gagtgtgcactgcgccatgtggagaagcagaagtcttgccgtgggctgaagctgatgtac
cgctacgatgaggagcagatcatcagtttggtcaaccagatatgtggcaaagtgtctggc
aaacacggtggcatcgagaactgtctcaacaaacccacaccaaaaagaggtccccgcaag
agagcgaccgtggatgtgccgccatctcggctcccatcctcatga

DBGET integrated database retrieval system