KEGG   Mus musculus (mouse): 16476Help
Entry
16476             CDS       T01002                                 

Gene name
Jun, AP-1, Junc, c-jun
Definition
(RefSeq) jun proto-oncogene
  KO
K04448  transcription factor AP-1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01522  Endocrine resistance
mmu04010  MAPK signaling pathway
mmu04012  ErbB signaling pathway
mmu04024  cAMP signaling pathway
mmu04137  Mitophagy - animal
mmu04210  Apoptosis
mmu04310  Wnt signaling pathway
mmu04380  Osteoclast differentiation
mmu04510  Focal adhesion
mmu04530  Tight junction
mmu04620  Toll-like receptor signaling pathway
mmu04621  NOD-like receptor signaling pathway
mmu04625  C-type lectin receptor signaling pathway
mmu04657  IL-17 signaling pathway
mmu04658  Th1 and Th2 cell differentiation
mmu04659  Th17 cell differentiation
mmu04660  T cell receptor signaling pathway
mmu04662  B cell receptor signaling pathway
mmu04668  TNF signaling pathway
mmu04722  Neurotrophin signaling pathway
mmu04912  GnRH signaling pathway
mmu04915  Estrogen signaling pathway
mmu04921  Oxytocin signaling pathway
mmu04926  Relaxin signaling pathway
mmu04932  Non-alcoholic fatty liver disease (NAFLD)
mmu04933  AGE-RAGE signaling pathway in diabetic complications
mmu05030  Cocaine addiction
mmu05031  Amphetamine addiction
mmu05132  Salmonella infection
mmu05133  Pertussis
mmu05135  Yersinia infection
mmu05140  Leishmaniasis
mmu05142  Chagas disease (American trypanosomiasis)
mmu05161  Hepatitis B
mmu05162  Measles
mmu05166  Human T-cell leukemia virus 1 infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05200  Pathways in cancer
mmu05203  Viral carcinogenesis
mmu05210  Colorectal cancer
mmu05211  Renal cell carcinoma
mmu05224  Breast cancer
mmu05231  Choline metabolism in cancer
mmu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mmu05321  Inflammatory bowel disease (IBD)
mmu05323  Rheumatoid arthritis
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    16476 (Jun)
   04012 ErbB signaling pathway
    16476 (Jun)
   04310 Wnt signaling pathway
    16476 (Jun)
   04668 TNF signaling pathway
    16476 (Jun)
   04024 cAMP signaling pathway
    16476 (Jun)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    16476 (Jun)
  09143 Cell growth and death
   04210 Apoptosis
    16476 (Jun)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    16476 (Jun)
   04530 Tight junction
    16476 (Jun)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    16476 (Jun)
   04621 NOD-like receptor signaling pathway
    16476 (Jun)
   04625 C-type lectin receptor signaling pathway
    16476 (Jun)
   04660 T cell receptor signaling pathway
    16476 (Jun)
   04658 Th1 and Th2 cell differentiation
    16476 (Jun)
   04659 Th17 cell differentiation
    16476 (Jun)
   04657 IL-17 signaling pathway
    16476 (Jun)
   04662 B cell receptor signaling pathway
    16476 (Jun)
  09152 Endocrine system
   04912 GnRH signaling pathway
    16476 (Jun)
   04915 Estrogen signaling pathway
    16476 (Jun)
   04921 Oxytocin signaling pathway
    16476 (Jun)
   04926 Relaxin signaling pathway
    16476 (Jun)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    16476 (Jun)
  09158 Development
   04380 Osteoclast differentiation
    16476 (Jun)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    16476 (Jun)
   05203 Viral carcinogenesis
    16476 (Jun)
   05231 Choline metabolism in cancer
    16476 (Jun)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    16476 (Jun)
  09162 Cancer: specific types
   05210 Colorectal cancer
    16476 (Jun)
   05211 Renal cell carcinoma
    16476 (Jun)
   05224 Breast cancer
    16476 (Jun)
  09163 Immune disease
   05323 Rheumatoid arthritis
    16476 (Jun)
   05321 Inflammatory bowel disease (IBD)
    16476 (Jun)
  09165 Substance dependence
   05030 Cocaine addiction
    16476 (Jun)
   05031 Amphetamine addiction
    16476 (Jun)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    16476 (Jun)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    16476 (Jun)
   04933 AGE-RAGE signaling pathway in diabetic complications
    16476 (Jun)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    16476 (Jun)
   05135 Yersinia infection
    16476 (Jun)
   05133 Pertussis
    16476 (Jun)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    16476 (Jun)
   05170 Human immunodeficiency virus 1 infection
    16476 (Jun)
   05162 Measles
    16476 (Jun)
   05161 Hepatitis B
    16476 (Jun)
   05167 Kaposi sarcoma-associated herpesvirus infection
    16476 (Jun)
   05169 Epstein-Barr virus infection
    16476 (Jun)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    16476 (Jun)
   05142 Chagas disease (American trypanosomiasis)
    16476 (Jun)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    16476 (Jun)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    16476 (Jun)
Transcription factors [BR:mmu03000]
 Eukaryotic Type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Jun
    16476 (Jun)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Jun bZIP_1 bZIP_2 bZIP_Maf ZapB PspA_IM30 Jnk-SapK_ap_N FlaC_arch Fib_alpha NBP1 TSC22 DUF3450 TFIIA
Motif
Other DBs
NCBI-GeneID: 16476
NCBI-ProteinID: NP_034721
MGI: 96646
Ensembl: ENSMUSG00000052684
Vega: OTTMUSG00000008035
UniProt: P05627 Q52L79
LinkDB All DBs
Position
4 C5; 4 43.34 cM
AA seq 334 aa AA seqDB search
MTAKMETTFYDDALNASFLQSESGAYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDL
LTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAE
LHSQNTLPSVTSAAQPVSGAGMVAPAVASVAGAGGGGGYSASLHSEPPVYANLSNFNPGA
LSSGGGAPSYGAAGLAFPSQPQQQQQPPQPPHHLPQQIPVQHPRLQALKEEPQTVPEMPG
ETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELAST
ANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgactgcaaagatggaaacgaccttctacgacgatgccctcaacgcctcgttcctccag
tccgagagcggtgcctacggctacagtaaccctaagatcctaaaacagagcatgaccttg
aacctggccgacccggtgggcagtctgaagccgcacctccgcgccaagaactcggacctt
ctcacgtcgcccgacgtcgggctgctcaagctggcgtcgccggagctggagcgcctgatc
atccagtccagcaatgggcacatcaccactacaccgacccccacccagttcttgtgcccc
aagaacgtgaccgacgagcaggagggcttcgccgagggcttcgtgcgcgccctggctgaa
ctgcatagccagaacacgcttcccagtgtcacctccgcggcacagccggtcagcggggcg
ggcatggtggctcccgcggtggcctcagtagcaggcgctggcggcggtggtggctacagc
gccagcctgcacagtgagcctccggtctacgccaacctcagcaacttcaacccgggtgcg
ctgagcagcggcggtggggcgccctcctatggcgcggccgggctggcctttccctcgcag
ccgcagcagcagcagcagccgcctcagccgccgcaccacttgccccaacagatcccggtg
cagcacccgcggctgcaagccctgaaggaagagccgcagaccgtgccggagatgccggga
gagacgccgcccctgtcccctatcgacatggagtctcaggagcggatcaaggcagagagg
aagcgcatgaggaaccgcattgccgcctccaagtgccggaaaaggaagctggagcggatc
gctcggctagaggaaaaagtgaaaaccttgaaagcgcaaaactccgagctggcatccacg
gccaacatgctcagggaacaggtggcacagcttaagcagaaagtcatgaaccacgttaac
agtgggtgccaactcatgctaacgcagcagttgcaaacgttttga

DBGET integrated database retrieval system