KEGG   Mus musculus (mouse): 16480Help
Entry
16480             CDS       T01002                                 

Gene name
Jup, Ctnng, D930025P04Rik, PG
Definition
(RefSeq) junction plakoglobin
  KO
K10056  junction plakoglobin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05200  Pathways in cancer
mmu05202  Transcriptional misregulation in cancer
mmu05221  Acute myeloid leukemia
mmu05226  Gastric cancer
mmu05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    16480 (Jup)
   05202 Transcriptional misregulation in cancer
    16480 (Jup)
  09162 Cancer: specific types
   05226 Gastric cancer
    16480 (Jup)
   05221 Acute myeloid leukemia
    16480 (Jup)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    16480 (Jup)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    16480 (Jup)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   16480 (Jup)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arm HEAT V-ATPase_H_N Cnd1 HEAT_2 Atx10homo_assoc Adaptin_N DUF3361 KAP Arm_2 PUL
Motif
Other DBs
NCBI-GeneID: 16480
NCBI-ProteinID: NP_034723
MGI: 96650
Ensembl: ENSMUSG00000001552
Vega: OTTMUSG00000006276
UniProt: Q02257
LinkDB All DBs
Position
11 D; 11 63.47 cM
AA seq 745 aa AA seqDB search
MEVMNLIEQPIKVTEWQQTYTYDSGIHSGVNTCVPSVSSKGIMDEDDACGRQYTLKKTTT
YTQGVPQNQGDLEYQMSTTARAKRVREAMCPGVSGEDSSLLLATQVEGQTTNLQRLAEPS
QLLKSAIVHLINYQDDAELATRALPELTKLLNDEDPVVVTKAAMIVNQLSKKEASRRALM
GSPQLVAAVVRTMQNTSDLDTARCTTSILHNLSHHREGLLAIFKSGGIPALVRMLSSPVE
SVLFYAITTLHNLLLYQEGAKMAVRLADGLQKMVPLLNKNNPKFLAITTDCLQLLAYGNQ
ESKLIILANGGPQGLVQIMRNYSYEKLLWTTSRVLKVLSVCPSNKPAIVEAGGMQALGKH
LTSNSPRLVQNCLWTLRNLSDVATKQEGLESVLKILVNQLSVDDVNVLTCATGTLSNLTC
NNSKNKTLVTQNSGVEALIHAILRAGDKDDITEPAVCALRHLTSRHPEAEMAQNSVRLNY
GIPAIVKLLNQPNQWPLVKATIGLIRNLALCPANHAPLQEAAVIPRLVQLLVKAHQDAQR
HVAAGTQQPYTDGVRMEEIVEGCTGALHILARDPMNRMEIFRLNTIPLFVQLLYSSVENI
QRVAAGVLCELAQDKEAADAIDAEGASAPLMELLHSRNEGTATYAAAVLFRISEDKNPDY
RKRVSVELTNSLFKHDPAAWEAAQSMIPINEPYADDMDATYRPMYSSDVPLDPLDMHMDL
DGDYPMDTYSDGLRPPYPTADHMLA
NT seq 2238 nt NT seq  +upstreamnt  +downstreamnt
atggaggtgatgaaccttattgagcagcccatcaaggtgacagagtggcaacagacatac
acctacgactcgggcatccactccggcgtcaatacctgtgtgccctctgtaagcagcaag
ggcatcatggatgaggatgatgcctgcggcagacagtacacactcaagaagactaccacc
tatacacaaggggtgccacagaaccaaggtgacctggaataccagatgtccacaacggcc
agagccaagcgggtgcgggaggccatgtgtccaggggtctcaggcgaggacagttctcta
ctgctggccacccaggtggaggggcagacaaccaatctgcagcgcctggccgaaccatcc
cagttgctcaagtcggccatcgtccatctcatcaactaccaggatgatgcagagctggcc
acccgggctctgcctgagctcaccaagctgctcaacgatgaggacccggtagtggtgacc
aaggcggctatgatcgtgaaccagctgtccaagaaggaggcatcccgccgggctctaatg
ggctcgccccagctggtggcggcggtggtgcggactatgcagaacaccagtgacctggat
actgcccggtgtaccaccagcatcctgcacaacctctctcaccaccgagagggcttgctc
gccatattcaagtctggaggcatccctgccctagtccgaatgctcagttcccccgtagaa
tctgtcctgttctacgccatcaccacactgcacaacctgctgctctatcaggagggcgcc
aagatggcggtgcgtctggcagacgggctgcagaagatggtgcccctactcaacaagaac
aaccctaagttcctggccatcactactgactgcctgcagctcctggcctatggcaaccag
gagagcaagctgatcatcctggccaatgggggaccccaagggcttgtgcagatcatgagg
aactacagctacgagaagcttctgtggaccaccagccgtgtgctcaaggtgctctccgtg
tgtcctagcaacaagcccgccatcgtggaggctggtgggatgcaggctctgggcaagcac
ttgacaagcaacagtccccgcctggtgcagaactgcctgtggactctgcgcaatctctcg
gatgtagccaccaagcaggagggcctggagagtgtgctgaagatcctggtcaaccaactg
agtgtagatgacgtcaacgtcctcacctgtgccacgggcaccctctccaacctgacctgc
aacaacagcaaaaacaagacgctggtgacacagaacagtggcgtggaggcgctcatccac
gccatcctgagagccggagacaaagatgacatcacagagcccgctgtctgtgccctgcgc
caccttaccagccgtcaccccgaggctgagatggcccagaactctgtgcgcctcaactat
ggaatcccggccattgtgaaactgctcaaccagccaaaccagtggccactggtcaaggca
actattggcctgatccggaacctggctctgtgcccagccaaccatgcccctctgcaggag
gccgcggtcattccccgcctcgtccagctgttggtcaaggcccaccaggacgcccagcgc
catgtggctgcaggcacccagcagccctacacggatggtgtgaggatggaggagatcgtg
gaaggctgcaccggagccctgcacatcctcgcccgggatcccatgaaccgcatggagatc
ttccggctcaacaccattcccctgtttgtccagctcctgtactcctctgtggagaacatc
cagcgtgtggctgcgggagtgctctgcgagctggcccaggacaaggaggctgccgacgcc
attgatgcggagggcgcctctgcccctctcatggagctactccattcccgcaatgagggc
accgcgacctacgctgctgctgtcctgttccgcatctctgaggacaagaacccagattac
cgtaagcgagtgtctgtggagctcaccaattccctcttcaagcatgacccagctgcctgg
gaggctgcccagagtatgatcccgatcaacgaaccctatgcagacgacatggatgccacc
taccgccccatgtactccagcgatgtgcctctggaccctctggacatgcacatggacctg
gatggagactaccccatggacacctacagtgacggcctgaggcctccctaccccactgca
gaccacatgctggcctag

DBGET integrated database retrieval system