KEGG   Mus musculus (mouse): 16576Help
Entry
16576             CDS       T01002                                 

Gene name
Kif7
Definition
(RefSeq) kinesin family member 7
  KO
K18806  kinesin family member 7
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04340  Hedgehog signaling pathway
mmu05200  Pathways in cancer
mmu05217  Basal cell carcinoma
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    16576 (Kif7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    16576 (Kif7)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    16576 (Kif7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    16576 (Kif7)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     16576 (Kif7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Kinesin Microtub_bd
Motif
Other DBs
NCBI-GeneID: 16576
NCBI-ProteinID: NP_001278151
MGI: 1098239
Ensembl: ENSMUSG00000050382
Vega: OTTMUSG00000044965
UniProt: J3QNW9
LinkDB All DBs
Position
7; 7 D2
AA seq 1348 aa AA seqDB search
MGLEAQRLPGAEEAPVRVALRVRPLLPKELLHGHQSCLRVEPERGRITLGRDRHFGFHVV
LGEDTGQEAVYQACVQPLLEAFFEGFNATVFAYGQTGSGKTYTMGEASVASLHEDEQGII
PRAMAEAFKLIDENDLLDCLVHVSYLELYKEEFRDLLEVGTASRDIQLREDDRGNVVLCG
VKEVDVEGLDEVLSLLEMGNAARHTGATHFNRLSSRSHTVFTVTLEQRGRTPSRLPRPAA
GHLLVSKFHFVDLAGSERVLKTGSTGERLKESIQINSTLLALGNVISALGDPQRRGSHIP
YRDSKITRILKDSLGGNAKTVMIACVSPSSSDFDETLNTLNYASRAQNIRNRATVNWRPE
AERVPEEQAAGARGPPRHRSETRIIHRGRRVPCPAVGSAAVAAGLGAECARCRARTSAAY
SLLRELQAEPGLPGAAARKVRDWLCAVEGERSTLSSASGPDSGIESAPAEDQAAQGTSGR
KGDEGTQQLLTLQSQVARLEEENRDFLAALEDAMEQYKLQSDRLREQQEEMVELRLRLEL
AQPGWGAPGLLQGLPPGSFVPRPHTAPLGGAHTHMLGMMPSTCLPGEEVSSEQQVVSGKE
VKAEVLAQADKLRSASSTTSEEEGEEEEEEEEEEEEPPRRTLYLRRNGISNWSQRAGLSP
GSPPDRKGPEVCPEEPAAAIPAPQAVGSGKVPVQTRQAPAAMASEWRLAQAQQKIRELAI
NIRMKEELIGELVRTGKAAQALNRQHSQRIRELEQEAERVRAELCEGQRQLRELEGREPQ
DASERSRLQEFRKRVAAAQSQVQVLKEKKQATERLVSLSAQSETRLQELERNVQLMRRQQ
GQLQRRLREETEQKRRLETEMNKRQHRVKELELKHEQQQKILKIKTEEIAAFQRKRRSGS
NGSVVSLEQQQKIEEQKKWLDQEMEKVLQQRRALEELGEELRKREVILAKKEALMQEKTG
LESKRLRSSQALNEDIVRVSSRLEHLEKELSEKSGQLRQGSAQNQQQIRGEIDTLRQEKD
SLLKQRLEIDSKLRQGSLLSPEEERTLFQLDEAIEALDAAIEYKNEAITCRQRVLRASAS
LLSQCEMNLMAKLSYLSSSETRALLCKYFDKVVTLREEQHQQQIAFSELEMQLEEQQRLV
YWLEVALERQRLEMDRQLTLQQKEHEQNVQLLLQQGRDHLGEGLADSKRQYEARIHALEK
ELGRHMWINQELKQKLSAGSTAGQSRGCERRSLCLENRQCLGNEDGLHPAAPEPLWQSSL
LEGVSRVWDESRDLVHAPLPLTWKRSSLCSEQGSSEESRVRETTEPPVGRVLPMGEVGLS
WNFGPLPKPRWEPRRTSPGMIDVRKNPL
NT seq 4047 nt NT seq  +upstreamnt  +downstreamnt
atggggctggaggcccagaggctgcctggggctgaggaggcccccgtgagggtggccctt
cgagttcgcccattgctgcccaaggagctgctgcatggtcatcagagttgcctgcgtgtg
gagcctgagcggggtcgaatcaccctggggcgggaccgacactttgggttccatgtggtc
ctgggagaggacactgggcaagaggctgtgtaccaggcttgcgtgcagcccctcctcgag
gctttctttgagggcttcaatgccaccgtctttgcctatggtcagacaggctctgggaag
acatataccatgggggaggccagtgtggcctccctgcatgaagatgaacaaggtatcatc
ccaagggccatggctgaggccttcaagctcattgatgagaatgacctgctggactgcctg
gtgcatgtatcctacctggaactctacaaggaagagttccgagatctgctagaagttggc
actgccagccgggacatccagcttcgggaagatgatcggggaaatgttgtgctctgtggg
gtgaaagaagtggatgtagaaggcctggacgaggtgctgagcctcctagagatgggcaat
gctgcgcgccacacaggcgccacacacttcaaccgcctctccagccgctcacacacagtc
ttcactgtgaccctggagcagcggggacggactcctagccgcttgcctcgacccgccgct
ggccacctgctggtctccaaattccacttcgtggacctggcaggctccgagagggttctg
aagaccggcagcaccggagaacggctcaaagagagcatccagattaacagcaccctgctg
gcgctgggaaatgtcattagcgccctgggggacccccagcgccgaggcagccacatccct
taccgtgattccaagatcacccggatcctcaaagactctctgggagggaatgccaagaca
gtgatgatcgcctgcgtcagcccctcctcctccgacttcgatgagaccctcaacacccta
aactacgccagccgtgctcagaacatccgcaatcgcgccacagtcaactggcgtccagag
gccgagcgcgtccctgaggaacaggcggcgggtgcgcgcgggccgccgcgacaccgctcg
gaaacgcgcatcatccatcgcggccggcgcgtgccctgccctgcagtgggctccgcggca
gtcgctgcgggcctgggggccgagtgcgcgcgctgccgggcccgcaccagcgccgcctac
agcctcctgcgagagcttcaggccgagcccgggctgcctggcgctgccgcccgcaaagtg
cgggactggctgtgcgcggtggagggcgagcgcagcaccttgagctctgcctccggaccc
gacagcggcatcgaaagcgctccagccgaggaccaggcggcacaggggaccagcgggaga
aagggagatgaggggacccagcagctgttgaccctgcagagccaggtggcccggctagag
gaggagaatcgagatttcctggcggctttggaggacgccatggagcagtacaaactgcag
agtgaccgcctgcgggagcagcaggaagagatggtagaactgcggctacgcctagagctg
gcacagcctggctggggtgcaccggggctcctgcagggcttgccaccgggatcctttgtg
ccccggcctcacacagcccccctggggggtgcccacactcacatgctgggcatgatgccc
tcgacatgtcttcctggagaagaagttagctctgagcagcaggtggtgagtggcaaggaa
gtcaaagcagaggtgttggcccaggcggacaaattgaggagtgcctcttccactacatca
gaggaggaaggggaggaggaggaggaagaggaggaagaagaagaggagccacccaggcgg
accttatacttgcgcagaaatgggatcagcaactggagtcagagggcagggttgagtcca
gggagcccacctgacaggaagggcccagaggtctgcccagaagagccagctgctgccatc
ccagcaccacaagcagtcggtagcggcaaggtcccagttcagacccgccaggccccagct
gccatggcctctgagtggcgactggcccaggcccaacagaaaatccgggaactggccatc
aacatccgcatgaaggaggagctcattggtgagctggtccggacagggaaggcggcccag
gccctgaaccgtcaacacagccagcgcatccgggagctggagcaggaggctgagcgtgtg
cgggcggagctgtgtgaagggcagaggcagcttcgagagctggagggcagggagccccaa
gatgccagcgagaggtccaggctccaggaattccgtaagagagtggctgcagcccaaagc
caggtgcaggtgctgaaggagaagaagcaggcaacagagcgactggtgtcactgtcggct
caaagtgagactcggctacaggagctggagaggaatgtgcagctcatgcggcgacagcag
gggcagctgcagaggcggctccgtgaggagacagagcagaagcggcgcctagagacggag
atgaacaagcggcagcatcgcgtcaaggagctggaactgaagcacgagcaacagcaaaag
atcctgaaaatcaagacagaagagattgcagccttccagaggaagaggcgcagtggcagc
aatggctctgtggtgagcctggagcagcagcagaagatcgaggagcagaagaagtggctg
gaccaggagatggaaaaggtgctgcagcagcggcgggcgctggaggagttgggagaggag
cttcgcaagcgggaggtcatcctggccaagaaggaggccctgatgcaggagaagacgggg
cttgagagcaagcgcctgaggtccagccaggccctaaatgaagacattgtgcgtgtgtcc
agccgcctagaacacctggagaaggagctatctgagaagagtgggcagctgcggcaaggc
agcgcccagaaccagcagcagatcagaggggagatagacaccctgcgccaagagaaggac
tcactgttgaagcaacgcctggagattgatagcaagctgaggcagggaagcctgctgtca
cctgaggaagagaggacactgttccagctggatgaagccatcgaggccctggacgctgcc
atcgagtacaagaatgaggctatcacatgccgccagcgggtgctacgggcttcggcctcc
ttgctgtcccagtgtgagatgaatctcatggcaaagctcagctacctttcctcctcagag
accagagccctgctgtgcaagtattttgacaaggtggtgacactccgagaggagcaacac
cagcaacagattgccttctcggagctggagatgcagctggaggagcagcagcggctggtg
tactggctggaggtggccctggagcggcagcgcctggagatggaccggcagctgaccctg
cagcagaaggagcacgagcagaatgtacagctgctcctccagcagggccgagaccacctt
ggcgaggggttagcagacagcaagaggcagtatgaggcccggattcacgctctggagaag
gaactaggtcgacacatgtggataaaccaggagctgaagcagaagctcagtgcaggaagc
actgcaggccagagccggggttgtgagaggagaagcctctgcctggaaaacagacaatgc
cttggaaatgaagatgggctccatcccgcagctcctgaacctctctggcagtcctccctt
ctggagggggtgtcccgtgtgtgggatgagtcccgggacttggtccatgccccactaccc
ctgacatggaaacgctcaagcttgtgcagcgagcagggctcctctgaggagtctagggtc
cgggagacaactgaacccccagtagggcgggtgctacctatgggtgaagtgggcctctcc
tggaactttggacccttgcccaagccccggtgggaaccccgaagaaccagcccagggatg
atcgacgtcaggaaaaaccccttgtag

DBGET integrated database retrieval system