KEGG   Mus musculus (mouse): 16590Help
Entry
16590             CDS       T01002                                 

Gene name
Kit, Bs, CD117, Fdc, Gsfsco1, Gsfsco5, Gsfsow3, SCO1, SCO5, SOW3, Ssm, Tr-kit, W, c-KIT
Definition
(RefSeq) KIT proto-oncogene receptor tyrosine kinase
  KO
K05091  proto-oncogene tyrosine-protein kinase Kit [EC:2.7.10.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04640  Hematopoietic cell lineage
mmu04916  Melanogenesis
mmu05200  Pathways in cancer
mmu05221  Acute myeloid leukemia
mmu05224  Breast cancer
mmu05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    16590 (Kit)
   04015 Rap1 signaling pathway
    16590 (Kit)
   04010 MAPK signaling pathway
    16590 (Kit)
   04072 Phospholipase D signaling pathway
    16590 (Kit)
   04151 PI3K-Akt signaling pathway
    16590 (Kit)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    16590 (Kit)
  09152 Endocrine system
   04916 Melanogenesis
    16590 (Kit)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    16590 (Kit)
   05230 Central carbon metabolism in cancer
    16590 (Kit)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    16590 (Kit)
   05224 Breast cancer
    16590 (Kit)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    16590 (Kit)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    16590 (Kit)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     16590 (Kit)
Protein kinases [BR:mmu01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   16590 (Kit)
CD molecules [BR:mmu04090]
 Proteins
  16590 (Kit)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase Ig_3 I-set ig Ig_2 Ig_4 Ig_5 V-set Ig_6 APH Pkinase_fungal UPF0220 DUF2039 C1-set
Motif
Other DBs
NCBI-GeneID: 16590
NCBI-ProteinID: NP_001116205
MGI: 96677
Ensembl: ENSMUSG00000005672
Vega: OTTMUSG00000016671
UniProt: P05532
LinkDB All DBs
Structure
PDB: 

Position
5 C3.3; 5 39.55 cM
AA seq 979 aa AA seqDB search
MRGARGAWDLLCVLLVLLRGQTATSQPSASPGEPSPPSIHPAQSELIVEAGDTLSLTCID
PDFVRWTFKTYFNEMVENKKNEWIQEKAEATRTGTYTCSNSNGLTSSIYVFVRDPAKLFL
VGLPLFGKEDSDALVRCPLTDPQVSNYSLIECDGKSLPTDLTFVPNPKAGITIKNVKRAY
HRLCVRCAAQRDGTWLHSDKFTLKVRAAIKAIPVVSVPETSHLLKKGDTFTVVCTIKDVS
TSVNSMWLKMNPQPQHIAQVKHNSWHRGDFNYERQETLTISSARVDDSGVFMCYANNTFG
SANVTTTLKVVEKGFINISPVKNTTVFVTDGENVDLVVEYEAYPKPEHQQWIYMNRTSAN
KGKDYVKSDNKSNIRYVNQLRLTRLKGTEGGTYTFLVSNSDASASVTFNVYVNTKPEILT
YDRLINGMLQCVAEGFPEPTIDWYFCTGAEQRCTTPVSPVDVQVQNVSVSPFGKLVVQSS
IDSSVFRHNGTVECKASNDVGKSSAFFNFAFKGNNKEQIQAHTLFTPLLIGFVVAAGAMG
IIVMVLTYKYLQKPMYEVQWKVVEEINGNNYVYIDPTQLPYDHKWEFPRNRLSFGKTLGA
GAFGKVVEATAYGLIKSDAAMTVAVKMLKPSAHLTEREALMSELKVLSYLGNHMNIVNLL
GACTVGGPTLVITEYCCYGDLLNFLRRKRDSFIFSKQEEQAEAALYKNLLHSTEPSCDSS
NEYMDMKPGVSYVVPTKTDKRRSARIDSYIERDVTPAIMEDDELALDLDDLLSFSYQVAK
GMAFLASKNCIHRDLAARNILLTHGRITKICDFGLARDIRNDSNYVVKGNARLPVKWMAP
ESIFSCVYTFESDVWSYGIFLWELFSLGSSPYPGMPVDSKFYKMIKEGFRMVSPEHAPAE
MYDVMKTCWDADPLKRPTFKQVVQLIEKQISDSTKHIYSNLANCNPNPENPVVVDHSVRV
NSVGSSASSTQPLLVHEDA
NT seq 2940 nt NT seq  +upstreamnt  +downstreamnt
atgagaggcgctcgcggcgcctgggatctgctctgcgtcctgttggtcctgctccgtggc
cagacagccacgtctcagccatctgcaagtccaggggagccgtctccgccatccatccat
ccagcacaatcagagttaatagttgaagctggcgacaccctcagcctgacgtgcattgat
cccgactttgtcagatggactttcaagacctatttcaatgaaatggttgagaataaaaaa
aatgaatggatccaggaaaaagccgaggccactcgcacgggcacatacacgtgcagcaac
agcaatggcctcacgagttctatttacgtgtttgttagagatcctgccaaacttttcctg
gttggccttcccttgtttggcaaagaagacagcgacgcgctggtccgctgccctctgaca
gacccacaggtgtccaattattccctcatcgagtgtgatgggaaatctctccccacggac
ctgacgtttgtcccaaaccccaaggctggcatcaccatcaaaaacgtgaagcgcgcctac
caccggctctgtgtccgctgtgctgctcagcgtgacggtacatggctgcattctgacaaa
ttcaccctcaaagtgcgggcagccatcaaggctatccctgttgtgtctgtgcctgaaaca
agtcacctccttaagaaaggggacacatttacggtggtgtgcaccataaaagatgtgtct
acatccgtgaactccatgtggctaaagatgaaccctcagcctcagcacatagcccaggta
aagcacaatagctggcaccggggtgacttcaattatgaacgccaggagacgctgactatc
agctcggcaagagttgacgattctggagtgttcatgtgttatgccaataatacttttgga
tcagcaaatgtcacaacaaccttgaaagtagtagaaaaaggattcatcaacatctcccct
gtgaagaacactacagtatttgtaaccgatggagaaaacgtagatttggttgttgaatac
gaggcctaccccaaacccgagcaccagcagtggatatatatgaacaggacctcggctaac
aaagggaaggattatgtcaaatctgataacaaaagcaacatcagatatgtgaaccaactt
cgcctgaccagattaaaaggcacagaaggaggcacttatacctttctggtgtccaactct
gatgccagtgcttccgtgacattcaacgtttacgtgaacacaaaaccagaaatcctgacg
tacgacaggctcataaatggcatgctccagtgtgtggcagagggattcccggagcccaca
atagattggtatttttgtacaggagcagagcaaaggtgtaccactcctgtctcaccagtg
gacgtacaggtccagaatgtatctgtgtcaccatttggaaaactggtggttcagagttcc
atagactccagcgtcttccggcacaacggcacggtggagtgtaaggcctccaacgatgtg
ggcaagagttccgccttctttaactttgcatttaaaggtaacaacaaagagcaaatccag
gcccacactctgttcacgccgctgctcattggctttgtggttgcagctggcgcgatgggg
atcattgtgatggtgctcacctacaaatatttgcagaaacccatgtatgaagtacaatgg
aaggttgtcgaggagataaatggaaacaattatgtttacatagacccgacgcaacttcct
tatgatcacaaatgggagtttcccagaaacaggctgagttttggaaagacattgggagct
ggtgccttcgggaaggtcgttgaggccactgcatatggcttgattaagtcggatgctgcc
atgacagttgccgtgaagatgctcaaaccaagtgcccatttaacagaaagagaggcccta
atgtcggaactgaaggtcctgagctacctgggcaatcacatgaatattgtgaacctgctt
ggcgcatgcacggtgggagggcccaccctggtcattacagaatattgttgctatggtgat
cttttgaattttttgagaaggaagcgtgactcgtttattttctcaaagcaagaagagcag
gcagaagcggcactttataagaaccttctgcactcaacggagccttcctgtgacagttca
aatgaatatatggacatgaagcctggcgtttcctacgtggtgccaaccaagacagacaag
aggagatccgcaagaatagactcgtacatagaaagagacgtgactcctgccatcatggaa
gatgacgagctggctctggacctggatgatttgctgagcttctcctaccaggtggccaag
ggcatggcgttcctcgcctccaagaattgtattcacagagatttggcagccaggaatatc
ctcctcactcacgggcggatcacaaagatttgcgatttcgggctagccagagacatcagg
aatgattcgaattacgtggtcaaaggaaatgcacgactgcccgtgaagtggatggcacca
gagagcattttcagctgcgtgtacacatttgaaagtgatgtctggtcctatgggattttc
ctctgggagctcttctccttaggaagcagcccctacccagggatgccggtcgactccaag
ttctacaagatgatcaaggaaggcttccggatggtcagcccggagcacgcgcctgccgaa
atgtatgacgtcatgaagacttgctgggacgctgaccccttgaaaaggccaacattcaag
caggttgtccaacttattgagaagcagatctcggacagcaccaagcacatttactccaac
ttggcaaactgcaaccccaacccagagaaccccgtggtggtggaccattccgtgagggtc
aactcggtgggcagcagcgcctcttctacgcagcccctgctcgtgcacgaagatgcctga

DBGET integrated database retrieval system