KEGG   Mus musculus (mouse): 16600Help
Entry
16600             CDS       T01002                                 

Gene name
Klf4, EZF, Gklf, Zie
Definition
(RefSeq) Kruppel-like factor 4 (gut)
  KO
K17846  krueppel-like factor 4
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    16600 (Klf4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    16600 (Klf4)
Transcription factors [BR:mmu03000]
 Eukaryotic Type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Krueppel-like
    16600 (Klf4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 DUF3850
Motif
Other DBs
NCBI-GeneID: 16600
NCBI-ProteinID: NP_034767
MGI: 1342287
Ensembl: ENSMUSG00000003032
Vega: OTTMUSG00000007231
UniProt: Q60793 F2YID5
LinkDB All DBs
Structure
PDB: 

Position
4 B3; 4 29.76 cM
AA seq 483 aa AA seqDB search
MRQPPGESDMAVSDALLPSFSTFASGPAGREKTLRPAGAPTNRWREELSHMKRLPPLPGR
PYDLAATVATDLESGGAGAACSSNNPALLARRETEEFNDLLDLDFILSNSLTHQESVAAT
VTTSASASSSSSPASSGPASAPSTCSFSYPIRAGGDPGVAASNTGGGLLYSRESAPPPTA
PFNLADINDVSPSGGFVAELLRPELDPVYIPPQQPQPPGGGLMGKFVLKASLTTPGSEYS
SPSVISVSKGSPDGSHPVVVAPYSGGPPRMCPKIKQEAVPSCTVSRSLEAHLSAGPQLSN
GHRPNTHDFPLGRQLPTRTTPTLSPEELLNSRDCHPGLPLPPGFHPHPGPNYPPFLPDQM
QSQVPSLHYQELMPPGSCLPEEPKPKRGRRSWPRKRTATHTCDYAGCGKTYTKSSHLKAH
LRTHTGEKPYHCDWDGCGWKFARSDELTRHYRKHTGHRPFQCQKCDRAFSRSDHLALHMK
RHF
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgaggcagccacctggcgagtctgacatggctgtcagcgacgctctgctcccgtccttc
tccacgttcgcgtccggcccggcgggaagggagaagacactgcgtccagcaggtgccccg
actaaccgttggcgtgaggaactctctcacatgaagcgacttcccccacttcccggccgc
ccctacgacctggcggcgacggtggccacagacctggagagtggcggagctggtgcagct
tgcagcagtaacaacccggccctcctagcccggagggagaccgaggagttcaacgacctc
ctggacctagactttatcctttccaactcgctaacccaccaggaatcggtggccgccacc
gtgaccacctcggcgtcagcttcatcctcgtcttccccggcgagcagcggccctgccagc
gcgccctccacctgcagcttcagctatccgatccgggccgggggtgacccgggcgtggct
gccagcaacacaggtggagggctcctctacagccgagaatctgcgccacctcccacggcc
cccttcaacctggcggacatcaatgacgtgagcccctcgggcggcttcgtggctgagctc
ctgcggccggagttggacccagtatacattccgccacagcagcctcagccgccaggtggc
gggctgatgggcaagtttgtgctgaaggcgtctctgaccacccctggcagcgagtacagc
agcccttcggtcatcagtgttagcaaaggaagcccagacggcagccaccccgtggtagtg
gcgccctacagcggtggcccgccgcgcatgtgccccaagattaagcaagaggcggtcccg
tcctgcacggtcagccggtccctagaggcccatttgagcgctggaccccagctcagcaac
ggccaccggcccaacacacacgacttccccctggggcggcagctccccaccaggactacc
cctacactgagtcccgaggaactgctgaacagcagggactgtcaccctggcctgcctctt
cccccaggattccatccccatccggggcccaactaccctcctttcctgccagaccagatg
cagtcacaagtcccctctctccattatcaagagctcatgccaccgggttcctgcctgcca
gaggagcccaagccaaagaggggaagaaggtcgtggccccggaaaagaacagccacccac
acttgtgactatgcaggctgtggcaaaacctataccaagagttctcatctcaaggcacac
ctgcgaactcacacaggcgagaaaccttaccactgtgactgggacggctgtgggtggaaa
ttcgcccgctccgatgaactgaccaggcactaccgcaaacacacagggcaccggcccttt
cagtgccagaagtgtgacagggccttttccaggtcggaccaccttgccttacacatgaag
aggcacttttaa

DBGET integrated database retrieval system