KEGG   Mus musculus (mouse): 16644Help
Entry
16644             CDS       T01002                                 

Gene name
Kng1, Kng
Definition
(RefSeq) kininogen 1
  KO
K03898  kininogen
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04022  cGMP-PKG signaling pathway
mmu04071  Sphingolipid signaling pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04610  Complement and coagulation cascades
mmu04750  Inflammatory mediator regulation of TRP channels
mmu04810  Regulation of actin cytoskeleton
mmu05142  Chagas disease (American trypanosomiasis)
mmu05143  African trypanosomiasis
mmu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    16644 (Kng1)
   04022 cGMP-PKG signaling pathway
    16644 (Kng1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    16644 (Kng1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    16644 (Kng1)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    16644 (Kng1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    16644 (Kng1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    16644 (Kng1)
  09174 Infectious disease: parasitic
   05142 Chagas disease (American trypanosomiasis)
    16644 (Kng1)
   05143 African trypanosomiasis
    16644 (Kng1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    16644 (Kng1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    16644 (Kng1)
Peptidases and inhibitors [BR:mmu01002]
 Peptidase inhibitors
  Family I25: cystatin family
   16644 (Kng1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   16644 (Kng1)
  Exosomal proteins of other cancer cells
   16644 (Kng1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cystatin Cathelicidins SQAPI Spp-24 Keratin_2_head
Motif
Other DBs
NCBI-GeneID: 16644
NCBI-ProteinID: NP_001095881
MGI: 1097705
Ensembl: ENSMUSG00000022875
Vega: OTTMUSG00000025899
UniProt: O08677 A0A0R4J038
LinkDB All DBs
Position
16; 16 B1
AA seq 661 aa AA seqDB search
MKLITTLLLCSGLLLTLTQGEEAQEIDCNDEAVFQAVDFSLKQFNPGVKSGNQYMLHRVI
EGTKTDGSPTFYSFKYLIKEGNCSAQSGLAWQDCDFKDAEEAATGECTATVGKRENEFFI
VTQTCKIAPSKAPILKAYFPCIGCVHAISTDSPDLEPVLKHSIEHFNNNTDHSHLFTLRK
VKSAHRQVVAGLNFDITYTIVQTNCSKERFPSLHGDCVALPNGDDGECRGNLFMDINNKI
ANFSQSCTLYSGDDLVEALPKPCPGCPRDIPVDSPELKEVLGHSIAQLNAENDHPFYYKI
DTVKKATSQVVAGTKYVIEFIARETKCSKESNTELAEDCEIKHLGQSLDCNANVYMRPWE
NKVVPTVKCQALDMTEMARRPPGFSPFRSVTVQETKEGRTVSPPYIAREQEERDAETEQG
PTHGHGWLHEKQIKANKNHRGHKHGHDHGHWSPRRHGLGHGHQKPHGLGHGHQLKLDYLR
HQREDGDDHTHTVGHGHGHGHGHGHGHGHGHGHGHGHGHGHGHGKHTNKDKNSVKQTTQR
TESLASSSEYSTTSTQMQGRTEGPTLTPPRAQPTVTSSGFQDSDFIEDVVATTPPYDTGA
HDDLIPDIHVQPDSLSFKLISDFPEATSPKCPGRPWKPASWKDPNTETTEFSDFDLLDAL
S
NT seq 1986 nt NT seq  +upstreamnt  +downstreamnt
atgaagctcattactacactgctcctctgctccggactcctgctgactttaacacaggga
gaagaagcgcaggaaattgactgcaatgatgaggctgtatttcaggctgtggatttctct
ctgaagcagtttaaccctggggtaaaaagtggcaaccagtatatgttgcaccgagtgatc
gagggcactaaaacggatggctctccaaccttttactccttcaagtatctaatcaaggag
ggcaactgctctgctcagagtggcctcgcatggcaggactgtgacttcaaggacgctgag
gaagccgccactggagaatgcacagcaactgtggggaaaagagaaaatgaattcttcata
gtcacccagacctgcaagattgctccaagtaaggcccccatactgaaagcctatttcccc
tgtattggttgtgtgcatgccatatcgacagatagtccagacctggagcctgttctgaaa
cactccatcgaacatttcaacaacaacacagatcacagccacctctttactctcagaaaa
gtaaaaagtgcccacagacaggtggtggctggcctgaattttgacattacctacacaatt
gtgcaaacaaattgttcaaaggagcgttttccttccctccatggagactgcgtggccctt
cccaatggtgatgatggtgaatgtagaggaaatctcttcatggatattaataacaaaatt
gccaacttctcacagagctgtaccctttattcaggagatgatttggtagaagcgcttccc
aagccttgccctggctgccccagggacatacctgtagacagcccagagctgaaggaggtg
cttggtcattccattgcacagctaaatgcagagaatgaccatcctttctattacaagatt
gacaccgtgaaaaaagcaacatcacaggtggtagcaggaactaaatatgttattgagttc
atagccagagaaaccaaatgctccaaggaaagtaacacagagctggcagaagattgtgag
atcaagcaccttggacaaagtctcgactgcaatgctaacgtgtacatgagaccttgggag
aacaaagtcgtcccgactgtgaaatgccaagcattagatatgactgaaatggcaagaagg
cctccaggtttttctcctttccggagtgtcacagtacaagaaacaaaagaaggaagaact
gtaagtccaccctacattgccagggagcaagaagagagggatgcagaaactgaacaagga
cccacacatgggcatggctggttgcatgaaaagcaaatcaaggctaataagaatcaccgt
ggtcataagcatgggcatgaccatggccattggtccccaaggaggcatggccttggtcat
ggacaccagaaaccacatggccttggtcatggacatcaacttaaacttgattatcttaga
caccaaagggaagatggtgatgaccatacacacacagtgggacatggtcatggtcacgga
catggtcatggtcatggacatggacatggtcatggtcacggtcatggtcatggtcatgga
catggtcatggtaagcatacaaataaagacaaaaacagtgtaaagcagactacccagaga
acagagtctttggcaagctcttctgaatacagtactacatctacacagatgcaggggagg
acagaagggcccaccttgacccctccccgagcccagccaactgttacctcttctggtttt
caggactcagatttcattgaagatgtggtagctaccaccccaccatatgacactggggcc
catgatgatttgatccctgatatccatgtacagccagatagcctttcatttaagctgata
tctgattttccagaagcaacttcccccaaatgtcctgggcgcccatggaagccagctagc
tggaaggatccaaacacagaaacaacagaattttctgattttgatctccttgatgctctt
tcttaa

KEGG   Mus musculus (mouse): 385643Help
Entry
385643            CDS       T01002                                 

Gene name
Kng2
Definition
(RefSeq) kininogen 2
  KO
K03898  kininogen
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04022  cGMP-PKG signaling pathway
mmu04071  Sphingolipid signaling pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04610  Complement and coagulation cascades
mmu04750  Inflammatory mediator regulation of TRP channels
mmu04810  Regulation of actin cytoskeleton
mmu05142  Chagas disease (American trypanosomiasis)
mmu05143  African trypanosomiasis
mmu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    385643 (Kng2)
   04022 cGMP-PKG signaling pathway
    385643 (Kng2)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    385643 (Kng2)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    385643 (Kng2)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    385643 (Kng2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    385643 (Kng2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    385643 (Kng2)
  09174 Infectious disease: parasitic
   05142 Chagas disease (American trypanosomiasis)
    385643 (Kng2)
   05143 African trypanosomiasis
    385643 (Kng2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    385643 (Kng2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    385643 (Kng2)
Peptidases and inhibitors [BR:mmu01002]
 Peptidase inhibitors
  Family I25: cystatin family
   385643 (Kng2)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   385643 (Kng2)
  Exosomal proteins of other cancer cells
   385643 (Kng2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cystatin Cathelicidins SQAPI Spp-24 Bradykinin
Motif
Other DBs
NCBI-GeneID: 385643
NCBI-ProteinID: NP_001095879
MGI: 3027157
Ensembl: ENSMUSG00000060459
Vega: OTTMUSG00000028303
UniProt: Q6S9I0 Q6S9I2
LinkDB All DBs
Position
16; 16 B1
AA seq 433 aa AA seqDB search
MKLITTLLLCSGLLLTLTQGEEAQEIDCNDEAVFQAVDASLKKLNARLQSGNQFVLYRVT
KRAKMDGSATFYSFNYQIKEGNCSAQRGLAWQDCDFKDSEEAATGECTATMGKKENKFFI
VTQTCKITPGKGPIVTEEYHCASCVHPISADNPDLEPVLKHAIEYFNNNTGHSHLFALRE
VKSAQGQVVGGLNFDIIYTIVQTNCSKERFPSLRGDCVALPNGDGGECRGNAFLDTDNKI
EDFTQSCDLHPGDDLVEALPKPCPGCPRDIPVDSPELKEVLGHSIAQLNTENDHPFYFKI
DTVKKATSQVVAGTNYVIEFIARETKCSKESNTELTEDCEIKHLGQSLDCNANVYMRPWE
NKVIPTVKCQALDKTIPIRRRPPGFSPFRSAKVQETKAGTTRLLRACEYKGRLSKAGAEP
APERQAESSQVKQ
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgaagctcattactacactgctcctctgctccggactcctgctgactttaacacaggga
gaagaagcgcaggaaattgactgcaatgatgaggctgtatttcaggctgtggatgcctct
ctgaagaagcttaatgctaggttacaaagcggcaaccagtttgtgttgtaccgagtgacc
aagcgcgctaaaatggatggctctgcaaccttttattccttcaattatcaaatcaaggag
ggcaactgctctgctcagagaggcctggcgtggcaggactgtgacttcaaggactctgag
gaagccgccactggagaatgcacagcaactatggggaagaaagaaaataagtttttcata
gtcacccagacctgcaagattactccaggtaagggccccatagtgacagaggagtaccac
tgtgcgagttgtgtgcatcccatatcggcagataatccagacctggagcctgttttgaaa
cacgccatcgaatatttcaacaacaacacaggtcacagccacctctttgctctcagagaa
gtaaaaagtgcccaaggacaggtggtgggtggcctgaattttgacattatctacacaatt
gtgcaaacaaattgttcaaaggagcgttttccttccctccgtggagactgtgtggcactt
cccaatggtgatggtggtgagtgtagaggtaatgctttcctggatactgataacaaaatt
gaggacttcacgcagagctgtgaccttcatccaggagatgatttggtagaagcgcttccc
aagccttgccctggctgccccagggacatacctgtagacagcccagagctgaaggaggtg
cttggtcattccattgcacagctaaatacagagaatgaccatcctttctatttcaagatt
gacaccgtgaaaaaagcaacatcacaggtggtagcaggaactaattatgttattgagttc
atagccagagaaaccaaatgttccaaggaaagtaacacagagctgacagaagattgtgag
atcaagcaccttggacaaagtctcgactgcaatgctaacgtgtacatgagaccttgggag
aacaaagtcatcccgactgtgaaatgccaagcattagataagactattcctatccgaagg
aggcctccaggcttttctcctttccggtcagccaaagtacaagaaacaaaagcaggaaca
actaggctcctacgcgcgtgcgagtacaagggcagactctcaaaggcaggggcagagcca
gcgcctgagcgtcaggcagaatcttcacaagtgaagcagtag

DBGET integrated database retrieval system