KEGG   Mus musculus (mouse): 16801Help
Entry
16801             CDS       T01002                                 

Gene name
Arhgef1, Lbcl2, Lsc
Definition
(RefSeq) Rho guanine nucleotide exchange factor (GEF) 1
  KO
K12330  Rho guanine nucleotide exchange factor 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04270  Vascular smooth muscle contraction
mmu04611  Platelet activation
mmu04810  Regulation of actin cytoskeleton
mmu04928  Parathyroid hormone synthesis, secretion and action
mmu05135  Yersinia infection
mmu05163  Human cytomegalovirus infection
mmu05200  Pathways in cancer
mmu05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    16801 (Arhgef1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    16801 (Arhgef1)
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    16801 (Arhgef1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    16801 (Arhgef1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    16801 (Arhgef1)
   05205 Proteoglycans in cancer
    16801 (Arhgef1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    16801 (Arhgef1)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    16801 (Arhgef1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    16801 (Arhgef1)
Membrane trafficking [BR:mmu04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    16801 (Arhgef1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RGS-like PH_16 RhoGEF PH_13 AbiJ_NTD3
Motif
Other DBs
NCBI-GeneID: 16801
NCBI-ProteinID: NP_001123624
MGI: 1353510
Ensembl: ENSMUSG00000040940
Vega: OTTMUSG00000029276
UniProt: Q61210
LinkDB All DBs
Position
7; 7 A3
AA seq 920 aa AA seqDB search
MGEVAGGAAPGPPRSGLVSIIIGAEDEDFENELEANSEDQNSQFQSLEQVKRRPAHLMAL
LQHVALQFEPGPLLCCLHADMLSSLGPKEAKKAFLDFYHSFLEKTAVLRVPVPPSVAFEL
DRTRPDLISEDVQRRFIQEVVQSQQAAVSRQLEDFRSKRLMGMTPWEQELSLLEPWIGKD
RGNYEARERHVAERLLSHLEETQHTISTDEEKSAAVVTAISLYMRHLGVRTKSGDKKSGR
NFFRKKVMGNRRSDEPPKTKKGLSSILDPARWNRGEPSAPDCRHLKVEADAEKPGPADRK
GGLGMSSRDRTVGTPGQDNPGVSLHPLSTDSVDSREPGVDTPQEPGDTPPQGPTSLEPLA
PPESTEDNGETESPEPGDDGEPGRSGLELEPEEPPGWRELVPPDTLLSLPKSQVKRQEVI
SELLVTEAAHVRMLRVLHDLFYQPMADGGFFPLDELQNIFPSLDELIEVHSLFLDRLMKR
RQESGYLIEEIGDVLLARFDGAEGSWFQKISSRFCSRQSFALEQLKAKQRKEPRFCAFVQ
EAESRPRCRRLQLKDMIPTEMQRLTKYPLLLQSIGQNTEESTERGKVELAAECCREILHH
VNQAVRDMEDLLRLKDYQRRLDLTHLRQSSDPMLSEFKNLDITKKKLVHEGPLTWRVTKD
KAIEVHVLLLDDLLLLLQRQDERLLLKSHSRTLTPTPDGKTMLRPVLRLTSAMTREVATD
HKAFYVIFTWDQEAQIYELVAQTSSERKNWCNLITETAGSLKVPAPASRLKPRPSPSSIR
EPLLSSSENGTGGAEMAPADARTERLLNDLLPFCRPGPEGQLAATALQKVLSLKQILLST
EEDSGAGPPRDGDGVPGGRAPGPVHTQEIEENLLSLEVAIRQLEELEEEFCRLRPLLSQL
GGTLSPNLAAPERSAQTGLS
NT seq 2763 nt NT seq  +upstreamnt  +downstreamnt
atgggagaagtcgccggaggggcggccccagggcctccccggtctggcctggtgtccatc
atcatcggggcggaggatgaggattttgagaacgagctggaggcgaactcagaagatcaa
aacagccagttccagagcctagagcaagtgaagcgccgccctgcccacctcatggccctc
ctgcagcatgtggccctgcagttcgagccaggaccactgctctgctgcctgcatgcagac
atgctgagctctctgggccccaaagaagccaagaaggccttccttgacttctatcacagt
ttcctggagaagactgcggttctacgggtgccggtccctcccagtgtcgcttttgaactt
gatcgtactcgacctgatctgatctctgaggatgtccagaggcggttcatacaagaggtg
gtgcagagccagcaggcagccgtgagccgtcagctagaggacttccgctccaagcggctc
atgggcatgacgccctgggagcaggaactgagcctgctggagccctggattgggaaagac
cgaggcaactatgaggcccgggagcggcatgttgcggagcggctgctgtcccacctggag
gagacccagcataccatctctacagatgaagagaaaagtgctgctgtggtcactgccatc
agcctgtatatgcgccaccttggagtccggaccaagagtggggacaagaagtcgggaagg
aacttcttccggaaaaaggtgatggggaatcggaggtcagacgaacccccaaagacaaag
aaagggctgagcagtatcctagatcctgcacgttggaaccggggagagccatccgctcca
gattgtcgacatctaaaggtcgaggctgatgcagagaagccaggccctgcagaccggaag
ggaggcctgggtatgtcttctcgggacaggactgttgggactcctggacaggacaaccca
ggagtctccctgcaccctctgtctacagacagcgtcgactcccgggaaccaggcgtggat
accccgcaggagccaggggatacacccccacagggccctaccagcctggagcccctggcg
cccccagagagcacagaggacaatggcgagactgagagccctgagcccggagatgatggg
gagccaggacggtcaggcctggaactggaaccagaagaacctcctgggtggagggaactc
gtgcccccagacaccctgctcagtctgcccaagagccaagtgaagcggcaagaggtcatc
agcgagctgctcgtgactgaggcagctcacgtgcgcatgctacgggtactgcatgacctc
ttctaccagcccatggcggatggaggcttcttccctctggacgagctgcagaacatcttc
ccgagcctggatgagctcatcgaggtgcactccctgttcctcgatcgcttgatgaagcgg
agacaagagagtggctacctcattgaggagatcggcgatgtgctactggcccggttcgat
ggtgctgagggctcatggttccagaagatctcctcccgcttctgcagccgccagtcgttc
gctctagagcagctcaaagccaagcagcgcaaggagcctcggttctgtgcctttgtgcag
gaagctgagagccgcccgagatgccggcgcctacagttaaaggacatgatccccactgag
atgcagcgactgaccaagtacccactgctgctacagagcatcgggcagaacacagaggag
tctacagaacgagggaaagtggagcttgcagctgagtgctgccgggagattctgcaccat
gtcaatcaagccgtccgtgacatggaggacctgctgcggctcaaggattaccagcggcgc
ctggacttgactcacctacggcagagcagtgaccctatgctgagcgagttcaagaacctg
gacatcactaagaagaagttggtccatgaaggccccctcacgtggcgagtgaccaaagac
aaagctatagaagtgcacgtgctcttgctggacgacctgctgctgctgctccagcgccag
gacgagaggctgctgctcaagtcccacagccggacgctgacacctacccccgatggcaag
accatgctgcggccggtgctccggctcacctctgccatgacccgagaggtggccactgat
cacaaagctttctacgtcatttttacctgggaccaggaggcccagatatatgagctggtg
gcacagacatcttcggaacgcaaaaactggtgtaacctcatcactgagactgctggatcc
ctgaaggtccctgcccctgcctcccgcctcaaaccccggcccagcccaagcagcatccga
gaacccctgctcagcagctctgagaatggcactggaggcgcagagatggctccagctgat
gccaggacagagcggctcctcaatgacctcctgcccttctgcagaccaggcccagagggc
cagcttgctgccacagcccttcagaaagtactgtccctgaagcagatcctgctaagcact
gaggaagacagtggagcggggcctccccgcgatggggatggggtgcctggtggtagggcc
cccggcccagtgcacacccaggagattgaggaaaacttgcttagcttagaggtggccatc
agacaactggaggagttggaagaggaattttgtcgcctaagacccctcctgtcccagctt
ggggggactctgtcccccaacctggctgcacctgaacgctctgctcagacaggcctttca
tga

KEGG   Mus musculus (mouse): 213498Help
Entry
213498            CDS       T01002                                 

Gene name
Arhgef11, PDZ-RhoGEF, Prg, RhoGEF, mKIAA0380
Definition
(RefSeq) Rho guanine nucleotide exchange factor (GEF) 11
  KO
K12331  Rho guanine nucleotide exchange factor 11
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04270  Vascular smooth muscle contraction
mmu04928  Parathyroid hormone synthesis, secretion and action
mmu05163  Human cytomegalovirus infection
mmu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    213498 (Arhgef11)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    213498 (Arhgef11)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    213498 (Arhgef11)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    213498 (Arhgef11)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    213498 (Arhgef11)
Membrane trafficking [BR:mmu04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    213498 (Arhgef11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RGS-like PH_16 RhoGEF PDZ PDZ_6 RGS PDZ_2
Motif
Other DBs
NCBI-GeneID: 213498
NCBI-ProteinID: NP_001003912
MGI: 2441869
Ensembl: ENSMUSG00000041977
Vega: OTTMUSG00000031939
UniProt: Q68FM7
LinkDB All DBs
Position
3; 3 F1
AA seq 1552 aa AA seqDB search
MSIRLPHSIDRLSSLSSLGDSTPERTSPSHHRQPSDTSETTGLVQRCVIIQKDQHGFGFT
VSGDRIVLVQSVRPGGAAMRAGVKEGDRIIKVNGTMVTNSSHLEVVKLIKSGAYVALTLL
GSSPSSIGVSGLQQNPSLSGGPRVNPMIPPPPPPPPLPPPQHITGPKPLQDPEVQKHATQ
ILRNMLRQEEKELQRICEVYSRNPASLLEEQIEGARRRVTQLQLKIQQETGGLVDVLPLC
GETSQRTCEGRLSVDSQEADSGLDSGTERFPSISESLVNRNSVLSDPGLDSPQTSPVILA
RVGQHHRRQGSDAAVHPLNHQGIDQSPKPLIIGPEEDYDPGYFNNESDIIFQDLEKLKSH
PAYLVVFLRYIFSQADPGPLLFYLCSEVYQQTNPKDSRNLGKDIWNIFLEKNAPLRVKIP
EMLQAEIDLRLRNSEDPRSALYEAQEAVMPEIQEQINDYRSKRTLGLGSLYGENDLLDLD
GDPLRERQMAEKQLAALGDILSKYEEDRSAPMDFAVNTYMSHTGIRLRESRPSSTAEKTQ
SAPDKDKWLPFFPKTKKSSNSKKEKDALEDKKRNPILRYIGKPKSSSQSIKPGNVRNIIQ
HFENSHQYDVPEPGTQRLSTGSFPEDLLESDSSRSEIRLGRSESLKGREEMKRSRKAENV
PRSRSDVDMDAAAEATRLHQSASSSASSLSTRSLENPTPPFTPKMGRRSIESPNLGFCTD
VILPHLLEDDLGQLSDLEPEPEVQNWQHTVGKDVVANLTQREIDRQEVINELFVTEASHL
RTLRVLDLIFYQRMKKENLMPREELSRLFPNLPELIEIHNSWCEAMKKLREEGPIIRDIS
DLMLARFDGPAREELQQVAAQFCSYQSVALELIRTKQRKESRFQLFMQEAESHPQCRRLQ
LRDLIISEMQRLTKYPLLLENIIKHTAGGTSEYEKLCRARDQCREILKFVNEAVKQTENR
HRLEGYQKRLDATALERASNPLAAEFKSLDLTTRKMIHEGPLTWRISKDKTLDLQVLLLE
DLVVLLQRQEEKLLLKCHSKTAVGSSDSKQTFSPVLKLNAVLIRSVATDKRAFFIICTSE
LGPPQIYELVALTSSDKNIWMELLEEAVQNATKHPGDAPVLNHPSPPGSQEPAYQGSTSS
RVEVNDSEVYPTEREPKKPSEGPGPEQRGQDKQLLAQEGPEQEEDAEELRALPCPPPSLD
GENRGIRTRDPVLLALTGPLLMEGLADAALEDVENLRHLILWSLLPGHTVKTQAAGEPED
DLTPTPSVVSITSHPWDPGSPGQAPAISDNTQFPRPEGSQPEGEDVALCSLAHLPPRTRN
SGIWDSPELDRNPAEEASSSEPAGSYKVVRKVSLLPGGGVGAAKVAGSNVTPALPESGQS
ESELSEVEGGAQATGNCFYVSMPAEPLDSSTEPPGTPPSLSQCHSLPAWPTEPPQHRGVT
GGQRSSLVLRDMGVIFHTIEQLTVKLHRLKDMELAHRELLNSLGGESSGGTTPVGSFHTE
AARWTDYSLSPPAKEALTSDPQNNQEQGSYPEEGSDTPLEDSATDTASSPGP
NT seq 4659 nt NT seq  +upstreamnt  +downstreamnt
atgagcatacggttgccccatagtatagacaggttaagtagcctgtcttctctgggagat
tctacacctgaacgcacatccccttctcaccaccgccagccctctgacacctctgagaca
acaggtcttgttcagcgctgtgtcatcatccaaaaggaccagcatggctttggcttcaca
gttagtggagatcgcattgtgctggtgcagtctgtgcgccctggaggcgcagccatgaga
gctggtgtgaaagagggtgaccggatcatcaaagtaaacggcaccatggtgaccaatagc
tcacacctggaggtagtgaagcttatcaaatctggcgcctatgttgcgcttaccctcctg
ggctcttctccttcctccatcggtgtctctgggctccagcagaacccttctctgtcagga
gggcccagagttaaccccatgattcctccaccacctcctcctccacccttgccacctcca
caacacattactggacctaaacctctacaggatcctgaagtccaaaagcacgccactcaa
atcctcaggaatatgctaaggcaggaggagaaggagttacagcgtatctgtgaggtgtat
agtcggaaccccgccagcctgctagaagagcaaatcgaaggtgcccggcggcgagtcact
caattacagctgaagatccagcaggagactggtggcttagtggatgtacttccactctgt
ggtgagaccagccagagaacatgtgaaggccgcctctctgtggactcccaggaggcagac
agtggcttggactcagggacagaacgctttccctccatcagtgagtcattggtgaatcgg
aactcagtattgtcagatcctggactagacagcccacaaacctcccctgtaatcctggcc
agggtgggccagcaccacaggcgacagggctcagatgcagcggtgcaccccctcaaccac
cagggtatagatcaaagcccaaagcctctgattattggcccagaggaagattatgaccca
ggctatttcaacaatgagagtgacatcatctttcaagatcttgaaaaactgaagtcacat
ccagcttacttggtagtatttctacgttacatcttctctcaggcagaccccggccccctg
cttttttatttgtgttcagaagtttatcagcagacaaatcccaaagattcccgaaatctg
gggaaagacatctggaatattttcctagagaaaaatgcgcctctcagagtgaagatccct
gagatgttgcaggctgagatcgacctacgcctgcgaaacagtgaggaccctcgcagcgcg
ctttatgaagctcaggaggcagtcatgccggagatccaggagcagatcaatgactataga
tcaaagcgcactctggggctgggcagcctctatggtgaaaatgacctactagacctggat
ggggaccctcttcgagagcgccaaatggctgagaagcaactggctgcccttggagatatc
ttgtccaaatatgaggaagatcggagtgctcccatggacttcgctgttaatacctacatg
agccacactgggatccgtcttcgggagtctcgaccttccagcacagcagaaaagacccag
tctgcccccgacaaggacaagtggctgcccttcttccctaagaccaagaagagcagcaat
tccaagaaagaaaaggacgccttggaggacaagaagcgaaaccccatcctcagatacatt
gggaagcccaagagctcttctcagagcattaagccaggcaatgtgaggaacatcattcag
cactttgagaacagccatcagtatgatgtcccagagccggggacacagcgactctcaaca
ggaagctttcctgaggacctgctggagagtgacagttcacgctcagagattcgccttggc
cgctctgaaagcctcaagggccgggaggagatgaagcgatcccggaaggcagagaatgtg
ccccggtctcgaagtgatgttgacatggatgctgctgctgaggctactcgccttcatcag
tcagcctcatcctctgcctccagcctctccaccaggtctcttgagaacccaacccctccc
ttcacccccaaaatgggccgcaggagcattgagtcccccaatctggggttctgtacagat
gtcatccttccccacctccttgaggatgatctgggccaactgtctgacctggagccagag
ccagaagtccaaaactggcagcatacagtgggcaaggatgtggtggcaaacttgacacag
agggaaattgaccggcaagaggtcatcaatgagctctttgtgacagaagcatcccacctg
cgcacgctacgagtcctggacctcatcttctaccagcgcatgaagaaggagaacctaatg
ccacgggaagagctgtcaaggctcttccctaatctgcctgaactcatagagatccacaat
tcctggtgtgaagccatgaagaagctccgggaggagggccccattatcagagacatcagt
gacctcatgctggctcggtttgatggtcctgcccgagaagagctccagcaagtagctgca
caattctgttcctatcagtcagtagccctggagctaatcaggactaaacaacgcaaggag
agtcgattccagctcttcatgcaggaagccgagagccacccccagtgtcggcgtctgcag
cttcgtgacctgatcatctctgagatgcagcggctcactaagtacccactgctgctagag
aacatcatcaagcacacagcgggtggcacatctgagtatgagaagctctgccgtgcccgg
gaccagtgccgagagattctcaagtttgtgaatgaagcagtgaagcagacagagaaccgt
caccgcttagaagggtaccagaaacgcctggatgccactgctctagagcgggccagcaac
cccttggcagcagagttcaagagcctggatcttacgacaaggaagatgatccacgagggg
cctctgacctggaggatcagcaaagataagaccctggacctccaggtgctgttactcgag
gacctggtagtgctgctgcagagacaagaggagaagctgctgctcaagtgccacagcaag
acagctgtgggctcctcagacagcaagcagaccttcagccctgtgctgaagctcaatgcc
gtgctcatccgctctgtggccacagataaacgagccttcttcatcatctgcacctccgag
ctgggccctccccagatctatgagctggttgcattgacatcatcagacaagaatatatgg
atggagctcttagaagaggctgtgcagaatgccaccaagcaccctggagatgccccagta
ctcaaccatccctcaccaccaggatcccaggagccagcctaccagggctccacctccagc
agggtagaggtgaatgactcggaagtgtatcccactgaaagagaacccaagaagccatct
gaaggccccgggcccgagcagagaggtcaagacaagcagctgctagcacaagaggggcct
gagcaggaggaggatgcagaggagctgagggccctgccttgccctcctccctccctggat
ggagaaaacagaggcatcaggacaagggaccctgtccttctggccctcacaggccctctg
ctcatggagggacttgctgatgctgccctggaagatgtggagaacttgcggcaccttatc
ctgtggagcctgctgcctggtcacactgtgaagactcaggctgctggcgagcctgaagat
gaccttacacccaccccttctgtcgtcagcattacctctcacccctgggacccaggatcc
ccagggcaagctcctgctataagtgacaacacccaatttccaaggccagagggaagccag
ccagagggcgaggatgttgctctctgttctctggcacacttgccaccaaggaccagaaat
tctggcatctgggactctcctgagctggataggaatccagctgaagaggcttcaagctca
gaaccagcaggaagttacaaagttgtaaggaaagtctctctactccctggtggtggtgtc
ggtgcagccaaggtggcgggcagcaatgttacccctgcactcccagagagtggccagtca
gaatctgagctatctgaagtggaaggcggagcacaggctacggggaactgtttctatgtc
agcatgccagcagaacctctggactctagcactgagcctcctgggacacccccaagtctc
tcgcagtgtcacagcctccctgcatggccaacagagcctccgcaacacaggggagtcact
gggggtcagcgttccagcctggtcctcagggatatgggtgtgatcttccacaccatcgag
caactgaccgtcaagcttcacagactcaaggacatggagctggcccacagagagctgctc
aactcccttggaggagagtcgtctggtggaaccactcctgtgggaagttttcacacagag
gcagccagatggacagactactccctctctcctccagccaaggaagccctgacctctgac
ccccaaaacaatcaggagcaggggtcctaccctgaagaaggctccgacacccccctggaa
gacagtgccacagacacagcttcgtcaccaggaccatag

KEGG   Mus musculus (mouse): 269608Help
Entry
269608            CDS       T01002                                 

Gene name
Plekhg5, BC023181, Syx
Definition
(RefSeq) pleckstrin homology domain containing, family G (with RhoGef domain) member 5
  KO
K19464  pleckstrin homology domain-containing family G member 5
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    269608 (Plekhg5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RhoGEF PH_13 PH_16 PH_5 PH_10 PH IQ_SEC7_PH HBM UNC-79
Motif
Other DBs
NCBI-GeneID: 269608
NCBI-ProteinID: NP_001272928
MGI: 2652860
Ensembl: ENSMUSG00000039713
Vega: OTTMUSG00000010225
UniProt: Q66T02 A0A2X0SG37
LinkDB All DBs
Position
4; 4 E2
AA seq 1073 aa AA seqDB search
MGTGPGVSGRRAAARPSSELPSPDSQLLWVGGHAHSSDSQVCHHADCQQLHHRGPLNLCE
TCDSKFHSTLHYDGHVRFDLPPQGSVLARNVSTRSCPPRTSPAADLEEEEEGCTDGKGDR
KSAGLKISKKKARRRHTDDPSKECFTLKFDLNVDIETEIVPAMKKKSLGEVLLPVFERKG
IALGKVDIYLDQSNTPLSLTFEAYRFGGHYLRVKAKPGDEGKVEQGVKDSKSLSLPALRP
SGAGPPVSERVDPQSRRESSLDILAPGRRRKNMSEFLGEAGIPGHEPPAPSSCSLPVGSS
GGTSSGINESWKNRAASRFSGFFSSSPSTSAFSREVDKMEQLESKLHAYSLFGLPRMPRR
LRFDHDSWEEEEEDDEEDEESSGLRLEDSWRELTDGHEKLTRRQCHQQEAVWELLHTEVS
YIRKLRVITNLFLCCLLNLQESGLLCEVEAERLFSNIPEIAKLHRGLWGSVMVPVLEKAR
RTRALLQPSDFLKGFKMFGSLFKPYIRYCMEEEGCMEYMRGLLRDNDLFRAYVTWAEKHQ
QCQRLKLSDMLAKPHQRLTKYPLLLKSVLRKTDDPRTKEAIVTMISSVERFIHHVNTCMR
QRQERQRLAGVVSRIDAYEVVEGSNDEVDKLLKEFLHLDLTAPMPGTSPEETRQLLLEGS
LRMKEGKDSKMDVYCFLFTDLLLVTKAVKKAERTKVIRPPLLVDKIVCRELRDPGSFLLI
YLNEFHSAVGAYTFQASSQALCRSWVDTIYNAQNQLQQLRAQLSAQEHPGSQHLQSLEEE
EDEQEEEGEESGTSAASSPTILRKSSNSLDSEHCTSDGSTETLAMVVVEPGATLSSPEFE
GGPVSSQSDESSLSNTASSVTPTSELLPLGPVDGRSCSMDSAYGTLSPTSLQDFVAPHPV
VEPAPVPQTPSPQPSPRLRRRTPVQLLPRPPRLLKSKSEASLLQLLSGTPAARGVPPAPS
RSLSELCLISVAPGVRTQRPLQEGGPGWNGPGMCDPCHGPQLSESENRPSHMTGGPADSA
RRRCREMPSGTMSRVQSEPPSGVSAQHRKLTLAQLYRIRTTLLLNSTLTASEV
NT seq 3222 nt NT seq  +upstreamnt  +downstreamnt
atggggacaggaccgggcgtctccgggcgccgagcagcagccaggcccagctctgagcta
ccctccccagactcccagctcctctgggtcgggggtcatgcccacagcagcgacagccag
gtatgccatcatgccgactgccagcagctgcaccaccgggggcctctcaacctgtgtgag
acctgtgatagcaagttccacagcaccctgcactacgacggccatgtccgatttgacctg
cccccgcaaggctctgtcctggcccggaatgtttccacccggtcctgtcctccccgcacc
agccctgctgcagacctggaggaagaagaggaaggctgtaccgacggaaaaggggaccgg
aagagcgccggcctaaaaatctctaagaagaaagcaaggaggagacacacagatgacccg
agcaaggagtgcttcaccttgaaattcgacctgaacgtggacatcgaaacagaaattgtg
ccagccatgaagaagaagtcactgggggaagtactgctgcctgtgtttgagaggaagggc
atcgcactgggcaaggtagacatctacctggatcaatccaacacacccctgtccctcacc
ttcgaggcctacaggtttggaggacactacctgcgggtcaaagccaagccgggggacgag
ggcaaggtggagcagggagtgaaggattccaagtccctcagtctgccagccctgaggccc
agtggggctgggccccctgtgtcggaacgtgtggaccctcagagccgccgagagagcagt
ctggacatcttggcccctggccgccgtcgcaagaacatgtctgaattcctgggagaggca
ggcatccctggacacgagccccccgcaccttccagctgttctctgcccgttggcagcagt
gggggtaccagcagtggcatcaatgagagctggaagaaccgggcagccagtcgcttcagc
ggcttcttcagctccagcccgagcaccagtgcctttagccgggaggtagacaagatggaa
cagctggagagcaagctccatgcctacagccttttcgggctaccccggatgcccaggagg
ctgcgctttgaccatgactcctgggaggaggaagaggaagatgacgaggaggatgaagag
agttcaggcctgaggctggaggacagctggagggagctcactgatgggcatgagaagctg
accaggcggcagtgccaccaacaggaggcagtgtgggaactcctccacacagaagtctcc
tacatccggaaactacgtgtgatcaccaacctgttcctgtgttgtcttcttaacctacaa
gagtcggggctcctgtgtgaggttgaggctgagcgcttgttcagcaacattcctgagatc
gccaagctacaccgcggcttgtggggcagcgtgatggtgccagtgctggagaaggcgcgg
cggacgcgggcgctgctgcagcccagcgactttctcaaaggcttcaagatgttcggctca
ctcttcaagccatacatccgatactgtatggaagaggagggctgcatggagtacatgcgc
ggcctgctgcgtgacaacgatctgttccgggcatacgtcacgtgggcggagaagcaccag
cagtgccagcggctgaagctgagtgacatgctggccaagccccaccagcggctcaccaaa
tacccactgctgctcaagtcggtgctaaggaagacagatgatccccgcaccaaggaagcc
atcgtcaccatgatcagctcggtggaacgcttcatacaccacgtgaacacgtgcatgcgg
cagcggcaggagcggcagcgcctggcgggggtggtgagccggatcgatgcctacgaggtt
gtggagggcagcaacgacgaggtggataagctcctgaaggaatttctacatctggacctg
acagcacccatgcctggaacctcccctgaagagacccgacagctgctgctggaagggagc
ctgaggatgaaggaggggaaagatagcaagatggacgtgtactgcttcctcttcactgac
ctactcttggtgaccaaggccgtgaagaaagcagagaggacgaaggtcatcaggccaccg
ctactggtggacaagattgtgtgccgggaacttcgggaccctggttccttcctcctcatc
tacctgaatgaattccacagtgctgtgggggcctacactttccaggccagcagccaggcc
ttgtgccggagctgggtggacactatttacaacgcacagaaccagctgcagcagctgcgt
gcacagctcagtgcacaggagcacccaggcagccagcatctgcagagcctggaagaggag
gaagatgagcaggaggaggagggtgaagagagcggtacctcagctgccagctcccccacc
atccttcgaaagagcagcaacagcctcgactctgagcactgcacctcagatggctccacg
gagaccctggccatggttgtggtagagcctggggcgacactgtcttccccggagtttgaa
ggcggtcccgtcagctcccagtcggacgaatcttctctcagtaacactgcttcctctgtc
actcccaccagcgagctgctgcccctgggccctgtggatggccgctcctgctccatggac
tccgcctatggcaccctgtcccccacttcccttcaagactttgtggctccacaccccgtg
gtcgagccagcgcctgtgcctcagaccccctctccccagccctcaccccgcctccgccgt
cgcactcctgtccagctgctccctcgcccgccccgcctgctcaagtccaaatcggaggct
agcctcttacaattactgtcaggaaccccagccgcccgtggcgtgcctccggctcccagc
cgcagcctgtcagaactgtgcctgatctctgtggcccctggggttaggactcagcgcccc
cttcaggaaggtggtcctggctggaatggtccagggatgtgtgacccctgccatggccct
cagttgtcagaatctgagaacagacctagccacatgacggggggacctgcagattctgcc
cgaaggagatgcagagagatgccttctgggactatgtccagggtgcagtctgagcctccc
tcaggggtctctgctcaacacaggaagctgaccctggcccagctctaccggatcaggacc
accctgctgctcaactccacgctcactgcctcggaggtgtga

KEGG   Mus musculus (mouse): 69632Help
Entry
69632             CDS       T01002                                 

Gene name
Arhgef12, 2310014B11Rik, AU019857, Larg, mKIAA0382
Definition
(RefSeq) Rho guanine nucleotide exchange factor (GEF) 12
  KO
K07532  Rho guanine nucleotide exchange factor 12
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04270  Vascular smooth muscle contraction
mmu04360  Axon guidance
mmu04611  Platelet activation
mmu04625  C-type lectin receptor signaling pathway
mmu04810  Regulation of actin cytoskeleton
mmu05135  Yersinia infection
mmu05152  Tuberculosis
mmu05163  Human cytomegalovirus infection
mmu05200  Pathways in cancer
mmu05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    69632 (Arhgef12)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    69632 (Arhgef12)
   04625 C-type lectin receptor signaling pathway
    69632 (Arhgef12)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    69632 (Arhgef12)
  09158 Development and regeneration
   04360 Axon guidance
    69632 (Arhgef12)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    69632 (Arhgef12)
   05205 Proteoglycans in cancer
    69632 (Arhgef12)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    69632 (Arhgef12)
   05152 Tuberculosis
    69632 (Arhgef12)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    69632 (Arhgef12)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    69632 (Arhgef12)
Membrane trafficking [BR:mmu04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    69632 (Arhgef12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RGS-like PH_16 RhoGEF PDZ_6 PDZ PDZ_2 PH_13 Ribonuc_2-5A AAA_23
Motif
Other DBs
NCBI-GeneID: 69632
NCBI-ProteinID: NP_001346161
MGI: 1916882
Ensembl: ENSMUSG00000059495
Vega: OTTMUSG00000063617
LinkDB All DBs
Position
9; 9 A5.1
AA seq 1543 aa AA seqDB search
MSGTQSTITDRFPLKKPIRHGSILNRESPTDKKQKVERSSSHDFDPTDSSSKKTKSSSEE
SRSEIYGLVQRCVIIQKDDNGFGLTVSGDNPVFVQSVKEDGAAMRAGVQTGDRIIKVNGT
LVTHSNHLEVVKLIRSGSYVALTVQGRPPGSPQIPLADSEVEPSVTGHMSPIMTSPHSPG
AAGNMERITSPVLVGEENNVVHNQKVEILRKMLQKEQERLQLLQEDYNRTATQRLLKEIQ
EAKKHIPQLQEQLSKATGSAQDGAVIAPSRPLGDALTLSEAEADPGDGLCRTDWSSGDAS
RPSSDSADSPKSSLRERSYLEEAPERSEGVQDAEPQSLVGSPSTRGAPHIIGAEDDDFGT
EHEQINGQCSCFQSIELLKSRPAHLAVFLHHVVSQFDPATLLCYLYSDLYKQTNSKETRR
VFLEFHQFFLDRSAHLKVPVPEEISVDLEKRRPELIPEDLHRLYIQTMQERVHPEVQRHL
EDFRQKRSMGLTLAESELTKLDAERDKDRGTLEKERACAEQIVTKIEEVLMTAQAVEEER
SSTMQYVILMYMKYLGVKVKEPRNLEHKRGRIGFLPKIKQSMKKDREGEEKGKRRGFPSI
LGPPRRPSRHDNSAIGRAMEIQKSRHPKHLSTPSSVSPEPQDPAKLRQSGVANEGTDTGY
LPASSMSSATSGTALSQEGGRENDTGTKQVGEASAPGDCLDSTPRVPTTVFDFPPPLLDQ
VQEEECEVERVAEHGTPKPFRKFDSIAFGESQSEDEQFENDLETDPPNWQQLVSREVLLG
LKPSEIKRQEVINELFYTERAHVRTLKVLDQVFYQRVSREGILSPSELRKIFSNLEDILQ
LHVGLNEQMKAVRKRNETSVIDHIGEDLLIWFSGPGEEKLKHAAATFCSNQPFALEMIKS
RQKKDSRFHTFVQDAESNPLCRRLQLKDIIPTQMQRLTKYPLLLDNIAKYTEWPPEREKV
KKAADHCRQILNYVNQAVREAENKQRLEDYQRRLDTSNLKLSEYPNVDELRNLDLTKRKM
IHEGPLVWKVNRDKSIDLYTLLLEDILVLLQKQDDRLVLRCHSKILASTADSKHTFSPVI
KLSTVLVRQVATDNKALFVISMSDNGAQIYELVAQTVSEKTVWQDLICRMAASVKEQSTK
PIPLPQPPPCEGDNDEEEPAKLKVEHHDLSVAGLQSPDRVLGLESPLISSKPQSHSLNTP
GKSAAEHLFVTATQFAKEQHANGALKEGDGGYPVTIPGPHLPVSEERWALDALRNLGLLK
QLLVQQLGLTEKSTQEDWQSFSRYGPASEEVQADSGIRDLENVKACHAREGQMSFKTGTG
DIATCDSPRTSTESCAAQDSVILASQDSQASNVLVMDHMILTPEMPPAEPEGGLDESGEH
FFDAREAHSDDNPSEGDGAVKKEEKDVNLRISGNCLILDGYDAVQESSTDEEVASSFPLQ
PVTGIPAVDSSHQQQHSPQNVHPEGPVSPFTPEFLVQRHWRAMEDTCFEIQSPSCTDSQS
QILEYIHKIEADLEHLKKVEESYALLCQRLAGSALPDKLSDKS
NT seq 4632 nt NT seq  +upstreamnt  +downstreamnt
atgagtggcacacagtctactatcacggacaggtttcccctcaaaaaacctataaggcat
ggaagtattttgaaccgagagtcaccaacagataagaaacagaaagttgaacgcagttca
tcgcatgattttgaccccacagatagctcctccaagaagacaaagtctagttcagaggag
agtagatccgagatctatggtcttgttcagcgctgtgtgatcatccagaaagacgacaat
ggcttcgggctgacagtcagtggagacaatccggtcttcgtacaatctgtcaaagaagat
ggagcagccatgcgtgctggagtacaaacaggtgatcgaatcatcaaggtgaatggtact
ctggtgactcattcaaatcatctggaggtggtgaaactaatcagatctggttcctatgta
gctctcactgtccagggacgcccacctgggtcgccccagatcccacttgctgattctgaa
gtagagccatcagtcactggacatatgtctcccattatgacatcccctcattcccctgga
gcagccgggaatatggagagaatcaccagtcctgtgctcgtgggggaggaaaacaatgtg
gtccataaccagaaagtagagattctgagaaagatgttacagaaggaacaggaacggctg
cagttgctgcaggaagattacaaccgaacggctacccaaagattgctcaaggagatccag
gaggccaagaagcacatcccgcagctgcaggagcagctgtccaaagccacgggctctgct
caggacggagctgtaattgcaccctccaggccattaggtgatgccctaacactcagtgag
gcagaagcagatcctggagatggcctgtgcaggactgactggagcagtggagatgcttct
cggcccagtagtgacagtgctgatagtcccaagagtagcctgagagaaaggagttacctg
gaggaagccccagagagaagtgaaggagttcaggacgctgagccgcagtcgctggtcggc
agtccctccacccggggcgcccctcacatcattggagcagaggatgatgattttggtact
gagcatgagcagatcaatggacagtgcagctgtttccagagcattgaattgctgaagtct
cgccctgctcacttggctgttttcttacaccatgtagtctcacagtttgaccctgcaaca
ttgctctgttatctctattcagacctgtataagcagacaaactccaaggagactcggcgt
gtcttcctggagtttcatcagttcttcttggaccggtctgcacacctgaaggttccagtt
cctgaggaaatctccgtggatctagaaaagagaagacctgagcttattcctgaggatctg
catcgcctctacattcagacaatgcaggagagagtccaccctgaagttcagaggcacttg
gaggatttccgacagaaacgcagcatggggctgaccttggctgagagtgagctgactaaa
cttgatgcagagagagacaaggaccggggaactctggagaaggagcgagcatgtgcggaa
cagatcgttaccaaaattgaagaagtgttgatgactgctcaggctgtagaagaagaaagg
agttccacaatgcagtatgtaattctcatgtatatgaagtatttgggagtaaaagtgaaa
gaacctcgaaacttggagcacaagcggggtcggatcggcttccttccaaagatcaagcaa
agcatgaagaaagatagagagggcgaagaaaaagggaagcgaagaggattccccagcatt
ttgggacccccaagaagaccaagccgccacgacaacagtgcaattggcagggccatggag
atacagaagtcacgccacccgaagcacttatccactccctcgtctgtgagtcctgagcct
caggaccctgccaagttgcgccagagtggagtagccaatgaaggaacagacactggatac
ctgcccgccagttccatgtcctctgccacctcagggactgctctttcccaagagggaggg
agagagaatgatacaggaacaaaacaagtgggagaagcatcggcgcctggagactgcttg
gacagcacacctcgagtccccactactgttttcgacttccctcctcctctattagatcaa
gtgcaggaggaggagtgtgaagtagagagggtggcagaacatgggaccccaaaacccttt
cggaagtttgacagcatcgcctttggagaaagtcagagtgaggatgagcagtttgaaaat
gacctggagacagatccacccaactggcagcagcttgttagcagagaagtgttactggga
ctgaaaccttctgagatcaaaagacaggaagtgattaatgaattgttctacactgagaga
gctcatgtccggacactgaaggttcttgaccaagtattctatcagcgagtgtccagagaa
gggattctatcaccttcagaactacgcaagattttttcaaacttggaagatatccttcaa
cttcatgttgggttgaatgagcaaatgaaagctgtccgaaaaaggaatgaaacttctgtt
attgatcatattggggaagatctgctcatctggtttagtggaccaggagaggagaagctg
aaacatgctgctgccacattctgcagtaaccaacctttcgccctggaaatgatcaagtct
cgccagaaaaaggattctcgattccatacttttgtgcaagacgctgagagtaaccccctg
tgccgtcgtcttcagctgaaggacatcattcccacccaaatgcagagactcactaagtac
ccgcttcttttggataacattgccaagtacacagaatggcctccagaaagggaaaaggtg
aagaaggctgcagaccattgtcgtcagatcttaaattatgtaaatcaggctgtcagggag
gcagaaaacaagcagcgcttagaagactatcagcgtcgccttgacacctccaatctcaag
ttgtccgagtacccaaatgttgacgagctcaggaatttggatttaacaaaaagaaagatg
attcatgaagggccgttggtctggaaggtgaatagagataaaagcatcgatctttataca
ctgctgctggaagacatccttgtgctgctacagaagcaggatgacaggctggtgctaagg
tgccacagcaagattctggcatccacagccgacagcaaacacaccttcagccctgtcatt
aagctgagcacggtgctggttcggcaggtggcgacagataacaaagctttattcgtcatc
tccatgtcagataatggagcccaaatttatgaattggtagcacagacggtttctgaaaag
acagtctggcaagacctcatctgtcgaatggctgcgtcagtgaaggagcagtctacaaag
ccgattcccctcccacagccgccaccttgcgaaggagacaatgatgaagaagaaccagcc
aagttaaaagtggagcaccatgatctttcagtcgctggtctgcaaagtccagacagagtt
ttgggattagaatctcccttaatttcgtcaaagcctcagtctcattcactgaatacccct
ggcaaatcagcggcagaacatctctttgtgaccgcaacacagtttgcaaaggaacagcat
gcaaatggggcactcaaggaaggtgatggcgggtatccagtcacaatcccaggtccacac
ttgcctgtgtcagaggagcggtgggcattggacgcactgagaaatttgggcttgttgaag
cagttgctggtacagcagttaggtctcaccgagaagagtactcaggaagactggcagtcc
ttctcacgatacgggccagcttctgaagaggtacaggcagacagtggcatccgggacttg
gaaaatgttaaggcttgtcatgccagggaaggacagatgtcttttaaaactggaactggt
gatattgcaacttgtgacagtccacggacttcaactgagtcttgtgctgcacaggattca
gtgatactggcatcccaagacagccaggcaagtaacgttttagtaatggaccacatgatc
ctgaccccagagatgcctcctgcagagccagaagggggtctggatgagagtggagagcac
ttttttgatgcccgtgaagcacatagtgatgataatccatcagaaggtgatggagcagtt
aaaaaggaagagaaggatgttaatttacgcatctcaggaaactgtttgatccttgatggc
tatgatgcagttcaggagagctccacagatgaggaggttgcctcctcgttccccctgcag
cctgtgacgggcatccccgctgtggactccagccaccagcagcaacattcccctcagaat
gtgcatcccgaggggccggtttcaccattcaccccagaattcctggtccagcggcactgg
cgagctatggaggatacctgttttgagatccagagtccctcatgtacagattcacaaagc
caaatcctggagtacattcataaaatagaggctgacctggaacacttaaagaaggtggag
gaaagttacgctcttctttgccaaaggctggctggctcagccctccccgacaagctctca
gataaaagttag

DBGET integrated database retrieval system