KEGG   Mus musculus (mouse): 16803Help
Entry
16803             CDS       T01002                                 

Gene name
Lbp, Bpifd2, Ly88
Definition
(RefSeq) lipopolysaccharide binding protein
  KO
K05399  lipopolysaccharide-binding protein
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04064  NF-kappa B signaling pathway
mmu04620  Toll-like receptor signaling pathway
mmu05132  Salmonella infection
mmu05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    16803 (Lbp)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    16803 (Lbp)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    16803 (Lbp)
   05152 Tuberculosis
    16803 (Lbp)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    16803 (Lbp)
   04147 Exosome [BR:mmu04147]
    16803 (Lbp)
Transporters [BR:mmu02000]
 Other Transporters
  Pores ion channels [TC:1]
   16803 (Lbp)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   16803 (Lbp)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LBP_BPI_CETP_C LBP_BPI_CETP PHA_gran_rgn
Motif
Other DBs
NCBI-GeneID: 16803
NCBI-ProteinID: NP_032515
MGI: 1098776
Ensembl: ENSMUSG00000016024
Vega: OTTMUSG00000015936
UniProt: Q61805
LinkDB All DBs
Structure
PDB: 

Position
2 H1; 2 78.72 cM
AA seq 481 aa AA seqDB search
MKAGTGPLLSTLLGLLFLSIQGTGGVNPGVVARITDKGLAYAAKEGLVALQRELYKITLP
DFSGDFKIKAVGRGQYEFHSLEIQNCELRGSSLKLLPGQGLSLAISDSSIGVRGKWKVRK
SFLKLHGSFDLDVKGVTISVDLLLGMDPSGRPTVSASGCSSRICDLDVHISGNVGWLLNL
FHNQIESKLQKVLENKVCEMIQKSVTSDLQPYLQTLPVTAEIDNVLGIDYSLVAAPQAKA
QVLDVMFKGEIFNRNHRSPVATPTPTMSLPEDSKQMVYFAISDYAFNIASRVYHQAGYLN
FSITDDMLPHDSGIRLNTKAFRPFTPQIYKKYPDMKLELLGTVVSAPILNVSPGNLSLAP
QMEIEGFVILPTSAREPVFRLGVVTNVFASLTFNNSKVTGMLHPDKAQVRLIESKVGMFN
VNLFQAFLNYYLLNSLYPDVNAELAQGFPLPLPRHIQLHDLDFQIRKDFLYLGANVQYMR
V
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctgggactggacctctgctctctacattgctggggctgctgttcctgtccata
cagggaactggcggtgtcaaccccggtgtggtggccaggatcaccgacaagggcctggcc
tacgcggccaaggaggggctggtggctctgcagagagagctgtacaagatcacactaccg
gacttcagcggggacttcaagatcaaggccgtgggtcgtgggcagtacgagtttcatagc
ctggagattcagaactgtgagctgcgtggctcctctctgaagctgctcccaggccagggc
ctgagtctcgccatctctgactcttccatcggtgtccgaggcaaatggaaggtgcgcaaa
tccttcctgaaacttcatggctcctttgacctggatgtcaaaggtgtcaccatttcagtg
gacctcctcctgggcatggatccctcagggcggcccacagtctctgcctctgggtgcagc
agccgcatttgtgatttggatgtgcacatatcaggaaatgtggggtggctgctgaatctc
ttccacaaccagatcgagtcgaagctccagaaagtactggagaataaggtttgtgagatg
atccagaagtctgtgacctctgacctgcagccttatctccagactctgccagtcacagca
gagatcgacaatgtcctgggcattgactacagtttggtggcggctccccaagcgaaggcc
caggtgctggatgtcatgtttaagggtgaaatttttaatcggaatcaccgctctccagtt
gctacccccactccgaccatgagcctacctgaggacagtaagcaaatggtctactttgcc
atctcagattatgccttcaacatagccagccgggtttatcaccaggctgggtacctgaat
ttttccatcacagatgacatgttaccacatgactccggcatccggttgaacaccaaggcc
ttccgtcccttcactccccagatatacaaaaagtatcccgacatgaaattggagctcctt
ggaacagtggtctctgccccgattctgaatgtcagtcctgggaatctgtccttggcccca
cagatggagatcgaaggctttgtgatcctgcccacctccgcccgggaacctgtcttccgg
cttggcgtggtcactaatgtatttgcctcattaactttcaacaacagcaaggttaccggg
atgctgcatccagacaaggcacaagtgagactgatcgaatccaaagtcggcatgttcaat
gtgaacctgttccaggcattccttaactactaccttctcaacagcctctaccctgatgtc
aatgctgagctggcccagggcttccccctccctctgccaaggcatattcagctccacgac
ctcgacttccagatccgcaaggacttcttatacttgggtgccaatgtccagtatatgaga
gtctga

DBGET integrated database retrieval system