KEGG   Mus musculus (mouse): 16818Help
Entry
16818             CDS       T01002                                 

Gene name
Lck, Hck-3, Lsk, Lskt, p56<lck>, p56Lck
Definition
(RefSeq) lymphocyte protein tyrosine kinase
  KO
K05856  lymphocyte cell-specific protein tyrosine kinase [EC:2.7.10.2]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04064  NF-kappa B signaling pathway
mmu04380  Osteoclast differentiation
mmu04650  Natural killer cell mediated cytotoxicity
mmu04658  Th1 and Th2 cell differentiation
mmu04659  Th17 cell differentiation
mmu04660  T cell receptor signaling pathway
mmu05135  Yersinia infection
mmu05166  Human T-cell leukemia virus 1 infection
mmu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mmu05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    16818 (Lck)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    16818 (Lck)
   04660 T cell receptor signaling pathway
    16818 (Lck)
   04658 Th1 and Th2 cell differentiation
    16818 (Lck)
   04659 Th17 cell differentiation
    16818 (Lck)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    16818 (Lck)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    16818 (Lck)
  09163 Immune disease
   05340 Primary immunodeficiency
    16818 (Lck)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    16818 (Lck)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    16818 (Lck)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    16818 (Lck)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    16818 (Lck)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     16818 (Lck)
Protein kinases [BR:mmu01001]
 Non-receptor tyrosine kinases
  SRC family
   16818 (Lck)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    16818 (Lck)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase SH2 SH3_1 SH3_2 SH3_9 Haspin_kinase Kdo
Motif
Other DBs
NCBI-GeneID: 16818
NCBI-ProteinID: NP_001155905
MGI: 96756
Ensembl: ENSMUSG00000000409
Vega: OTTMUSG00000009667
UniProt: P06240
LinkDB All DBs
Position
4 D2.2; 4 63.26 cM
AA seq 509 aa AA seqDB search
MGCVCSSNPEDDWMENIDVCENCHYPIVPLDSKISLPIRNGSEVRDPLVTYEGSLPPASP
LQDNLVIALHSYEPSHDGDLGFEKGEQLRILEQSGEWWKAQSLTTGQEGFIPFNFVAKAN
SLEPEPWFFKNLSRKDAERQLLAPGNTHGSFLIRESESTAGSFSLSVRDFDQNQGEVVKH
YKIRNLDNGGFYISPRITFPGLHDLVRHYTNASDGLCTKLSRPCQTQKPQKPWWEDEWEV
PRETLKLVERLGAGQFGEVWMGYYNGHTKVAVKSLKQGSMSPDAFLAEANLMKQLQHPRL
VRLYAVVTQEPIYIITEYMENGSLVDFLKTPSGIKLNVNKLLDMAAQIAEGMAFIEEQNY
IHRDLRAANILVSDTLSCKIADFGLARLIEDNEYTAREGAKFPIKWTAPEAINYGTFTIK
SDVWSFGILLTEIVTHGRIPYPGMTNPEVIQNLERGYRMVRPDNCPEELYHLMMLCWKER
PEDRPTFDYLRSVLDDFFTATEGQYQPQP
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgggctgtgtctgcagctcaaaccctgaagatgactggatggagaacattgacgtgtgt
gaaaactgccactatcccatagtcccactggacagcaagatctcgctgcccatccggaat
ggctctgaagtgcgggacccactggtcacctatgagggatctctcccaccagcatccccg
ctgcaagacaacctggttatcgccctgcacagttatgagccctcccatgatggagacttg
ggctttgagaagggtgaacagctccgaatcctggagcagagcggtgagtggtggaaggct
cagtccctgacgactggccaagaaggcttcattcccttcaacttcgtggcgaaagcaaac
agcctggagcctgaaccttggttcttcaagaatctgagccgtaaggacgccgagcggcag
cttttggcgcccgggaacacgcatggatccttcctgatccgggaaagcgaaagcactgcg
gggtccttttccctgtcggtcagagacttcgaccagaaccagggagaagtggtgaaacat
tacaagatccgtaacctagacaacggtggcttctacatctcccctcgtatcacttttccc
ggattgcacgatctagtccgccattacaccaacgcctctgatgggctgtgcacaaagttg
agccgtccttgccagacccagaagccccagaaaccatggtgggaggacgaatgggaagtt
cccagggaaacactgaagttggtggagcggctgggagctggccagttcggggaagtgtgg
atggggtactacaacggacacacgaaggtggcggtgaagagtctgaaacaagggagcatg
tcccccgacgccttcctggctgaggctaacctcatgaagcagctgcagcacccgcggcta
gtccggctttatgcagtggtcacccaggaacccatctacatcatcacggaatacatggag
aacgggagcctagtagattttctcaagactccctcgggcatcaagttgaatgtcaacaaa
cttttggacatggcagcccagattgcagagggcatggcgttcatcgaagaacagaattac
atccatcgggacctgcgcgccgccaacatcctggtgtctgacacgctgagctgcaagatt
gcagactttggcctggcgcgcctcattgaggacaatgagtacacggcccgggagggggcc
aaatttcccattaagtggacagcaccagaagccattaactatgggaccttcaccatcaag
tcagacgtgtggtccttcgggatcttgcttacagagatcgtcacccacggtcgaatccct
tacccaggaatgaccaaccctgaagtcattcagaacctggagagaggctaccgcatggtg
agacctgacaactgtccggaagagctgtaccacctcatgatgctgtgctggaaggagcgc
ccagaggaccggcccacgtttgactaccttcggagtgttctggatgacttcttcacagcc
acagagggccagtaccagccccagccttga

DBGET integrated database retrieval system