KEGG   Mus musculus (mouse): 16842Help
Entry
16842             CDS       T01002                                 

Gene name
Lef1, 3000002B05, AI451430, Lef-1
Definition
(RefSeq) lymphoid enhancer binding factor 1
  KO
K04492  lymphoid enhancer-binding factor 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04310  Wnt signaling pathway
mmu04390  Hippo signaling pathway
mmu04520  Adherens junction
mmu04916  Melanogenesis
mmu04934  Cushing syndrome
mmu05200  Pathways in cancer
mmu05210  Colorectal cancer
mmu05213  Endometrial cancer
mmu05215  Prostate cancer
mmu05216  Thyroid cancer
mmu05217  Basal cell carcinoma
mmu05221  Acute myeloid leukemia
mmu05224  Breast cancer
mmu05225  Hepatocellular carcinoma
mmu05226  Gastric cancer
mmu05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    16842 (Lef1)
   04390 Hippo signaling pathway
    16842 (Lef1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    16842 (Lef1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    16842 (Lef1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    16842 (Lef1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    16842 (Lef1)
   05225 Hepatocellular carcinoma
    16842 (Lef1)
   05226 Gastric cancer
    16842 (Lef1)
   05216 Thyroid cancer
    16842 (Lef1)
   05221 Acute myeloid leukemia
    16842 (Lef1)
   05217 Basal cell carcinoma
    16842 (Lef1)
   05215 Prostate cancer
    16842 (Lef1)
   05213 Endometrial cancer
    16842 (Lef1)
   05224 Breast cancer
    16842 (Lef1)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    16842 (Lef1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    16842 (Lef1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    16842 (Lef1)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    16842 (Lef1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2
Motif
Other DBs
NCBI-GeneID: 16842
NCBI-ProteinID: NP_034833
MGI: 96770
Ensembl: ENSMUSG00000027985
Vega: OTTMUSG00000020276
UniProt: P27782 Q3TYB0 Q8BGZ9
LinkDB All DBs
Structure
PDB: 

Position
3 G3; 3 60.78 cM
AA seq 397 aa AA seqDB search
MPQLSGGGGGGDPELCATDEMIPFKDEGDPQKEKIFAEISHPEEEGDLADIKSSLVNESE
IIPASNGHEVVRQAPSSQEPYHDKAREHPDEGKHPDGGLYNKGPSYSSYSGYIMMPNMNS
DPYMSNGSLSPPIPRTSNKVPVVQPSHAVHPLTPLITYSDEHFSPGSHPSHIPSDVNSKQ
GMSRHPPAPEIPTFYPLSPGGVGQITPPIGWQGQPVYPITGGFRQPYPSSLSGDTSMSRF
SHHMIPGPPGPHTTGIPHPAIVTPQVKQEHPHTDSDLMHVKPQHEQRKEQEPKRPHIKKP
LNAFMLYMKEMRANVVAECTLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQL
YPGWSARDNYGKKKKRKREKLQESTSGTGPRMTAAYI
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgccccaactttccggaggaggcggcgggggggacccggaactctgcgccaccgatgag
atgatccccttcaaggacgaaggcgatccccagaaggagaagatcttcgccgagatcagt
catcccgaagaggagggcgacttagccgacatcaagtcatctttggttaacgagtccgaa
atcatcccagccagcaacgggcatgaggtggtcagacaagccccgtcctctcaggagccc
taccacgacaaggccagagaacaccctgatgaaggaaagcatccagacggaggcctgtac
aacaagggaccctcctactccagttactctggctacataatgatgcccaatatgaacagc
gacccgtacatgtcaaatgggtccctttctccacccatcccgaggacatcaaataaagtg
cccgtggtgcagccctctcacgcggtccacccgctcacccccctcatcacctacagcgac
gagcacttttctccgggatcccacccgtcacacatcccgtcagatgtcaactccaagcaa
ggcatgtccagacaccctccagctcctgaaatccccaccttctaccccctgtctccgggc
ggcgttggacagatcaccccacccattggctggcaaggtcagcctgtttatcccatcacg
ggtggattcaggcaaccctacccatcctcactgtcaggcgacacttccatgtccaggttt
tcccatcatatgattcctggtccccctggcccccacacaactggcatccctcatccagct
attgtaacacctcaggtcaaacaggagcacccccacacggacagtgacctaatgcacgtg
aagcctcaacacgaacagagaaaggagcaggagcccaaaagacctcatattaagaagcct
ctgaatgctttcatgttatatatgaaagaaatgagagcgaatgtcgtagctgagtgcacg
ctaaaggagagtgcagctatcaaccagatcctgggcagaagatggcacgccctctcccgg
gaagagcaggccaaatactatgaactagcacggaaagagagacagctacacatgcagctt
tatccaggctggtcagcgcgagacaattatggcaagaagaagaagaggaagagagagaag
ctacaggagtcgacttcaggtacaggtcccagaatgacagctgcctacatctga

KEGG   Mus musculus (mouse): 21414Help
Entry
21414             CDS       T01002                                 

Gene name
Tcf7, AI465550, TCF-1, Tcf1
Definition
(RefSeq) transcription factor 7, T cell specific
  KO
K02620  transcription factor 7
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04310  Wnt signaling pathway
mmu04390  Hippo signaling pathway
mmu04520  Adherens junction
mmu04550  Signaling pathways regulating pluripotency of stem cells
mmu04916  Melanogenesis
mmu04934  Cushing syndrome
mmu05165  Human papillomavirus infection
mmu05200  Pathways in cancer
mmu05210  Colorectal cancer
mmu05213  Endometrial cancer
mmu05215  Prostate cancer
mmu05216  Thyroid cancer
mmu05217  Basal cell carcinoma
mmu05221  Acute myeloid leukemia
mmu05224  Breast cancer
mmu05225  Hepatocellular carcinoma
mmu05226  Gastric cancer
mmu05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    21414 (Tcf7)
   04390 Hippo signaling pathway
    21414 (Tcf7)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    21414 (Tcf7)
   04550 Signaling pathways regulating pluripotency of stem cells
    21414 (Tcf7)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    21414 (Tcf7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    21414 (Tcf7)
  09162 Cancer: specific types
   05210 Colorectal cancer
    21414 (Tcf7)
   05225 Hepatocellular carcinoma
    21414 (Tcf7)
   05226 Gastric cancer
    21414 (Tcf7)
   05216 Thyroid cancer
    21414 (Tcf7)
   05221 Acute myeloid leukemia
    21414 (Tcf7)
   05217 Basal cell carcinoma
    21414 (Tcf7)
   05215 Prostate cancer
    21414 (Tcf7)
   05213 Endometrial cancer
    21414 (Tcf7)
   05224 Breast cancer
    21414 (Tcf7)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    21414 (Tcf7)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    21414 (Tcf7)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    21414 (Tcf7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    21414 (Tcf7)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    21414 (Tcf7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HMG_box CTNNB1_binding HMG_box_2
Motif
Other DBs
NCBI-GeneID: 21414
NCBI-ProteinID: NP_001300910
MGI: 98507
Ensembl: ENSMUSG00000000782
Vega: OTTMUSG00000005622
UniProt: Q00417 Q80UF1
LinkDB All DBs
Position
11 B1.3; 11 31.86 cM
AA seq 303 aa AA seqDB search
MYKETVYSAFNLLMPYPPASGAGQHPQPQPPLHNKPGQPPHGVPQLSPLYEHFSSPHPTP
APADISQKQGVHRPLQTPDLSGFYSLTSGSMGQLPHTVSWPSPPLYPLSPSCGYRQHFPA
PTAAPGAPYPRFTHPSLMLGSGVPGHPAAIPHPAIVPSSGKQELQPYDRNLKTQAEPKAE
KEAKKPVIKKPLNAFMLYMKEMRAKVIAECTLKESAAINQILGRRWHALSREEQAKYYEL
ARKERQLHMQLYPGWSARDNYGKKKRRSREKHQESTTGGKRNAFGTYPEKAAAPAPFLPM
TVL
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgtacaaagagactgtctactctgccttcaatctgctcatgccctacccaccggcctcc
ggagcagggcagcatccgcagcctcaacccccgctgcataacaagcccggccagcctcca
catggcgtcccccagctttctccactctacgaacatttcagcagtccacaccccacccct
gcaccagcggacatcagccagaagcaaggagttcacaggccgctgcagacccccgatctc
tctggattttattctctgacctcaggcagcatgggacagctcccccatactgtgagctgg
cccagtcctcctctctaccccctgtccccttcctgcggatatagacagcacttccctgcc
cccactgcagcccctggcgccccctatcccaggttcacccacccatccttgatgctggga
tctggtgtacctggacacccagcagccatccctcacccggccattgtgccctcctcaggg
aagcaggagctgcagccatatgatagaaacctgaaaacacaggcagaacccaaggcagag
aaggaggctaagaagccagtcatcaagaaacccctcaatgcgttcatgctttacatgaag
gagatgagagccaaggtcattgctgagtgcacactcaaggagagcgctgccatcaaccag
atcctgggtcgcaggtggcatgcactatctcgagaagagcaggccaagtactatgaactg
gcccgcaaggaaaggcagctgcacatgcagctatacccgggctggtccgcgcgggataac
tacggaaagaagaagaggcggtcaagggaaaaacatcaagaatccaccacaggaggaaaa
agaaatgcattcggtacttacccggagaaggccgctgccccagccccgttccttccgatg
acagtgctctag

KEGG   Mus musculus (mouse): 21415Help
Entry
21415             CDS       T01002                                 

Gene name
Tcf7l1, Tcf-3, Tcf3, bHLHb21
Definition
(RefSeq) transcription factor 7 like 1 (T cell specific, HMG box)
  KO
K04490  transcription factor 7-like 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04310  Wnt signaling pathway
mmu04390  Hippo signaling pathway
mmu04520  Adherens junction
mmu04916  Melanogenesis
mmu04934  Cushing syndrome
mmu05165  Human papillomavirus infection
mmu05200  Pathways in cancer
mmu05210  Colorectal cancer
mmu05213  Endometrial cancer
mmu05215  Prostate cancer
mmu05216  Thyroid cancer
mmu05217  Basal cell carcinoma
mmu05221  Acute myeloid leukemia
mmu05224  Breast cancer
mmu05225  Hepatocellular carcinoma
mmu05226  Gastric cancer
mmu05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    21415 (Tcf7l1)
   04390 Hippo signaling pathway
    21415 (Tcf7l1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    21415 (Tcf7l1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    21415 (Tcf7l1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    21415 (Tcf7l1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    21415 (Tcf7l1)
   05225 Hepatocellular carcinoma
    21415 (Tcf7l1)
   05226 Gastric cancer
    21415 (Tcf7l1)
   05216 Thyroid cancer
    21415 (Tcf7l1)
   05221 Acute myeloid leukemia
    21415 (Tcf7l1)
   05217 Basal cell carcinoma
    21415 (Tcf7l1)
   05215 Prostate cancer
    21415 (Tcf7l1)
   05213 Endometrial cancer
    21415 (Tcf7l1)
   05224 Breast cancer
    21415 (Tcf7l1)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    21415 (Tcf7l1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    21415 (Tcf7l1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    21415 (Tcf7l1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    21415 (Tcf7l1)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    21415 (Tcf7l1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2
Motif
Other DBs
NCBI-GeneID: 21415
NCBI-ProteinID: NP_033358
MGI: 1202876
Ensembl: ENSMUSG00000055799
Vega: OTTMUSG00000021200
UniProt: Q9Z1J1 A1A550
LinkDB All DBs
Position
6 C1; 6 32.27 cM
AA seq 585 aa AA seqDB search
MPQLGGGRGGGAGGGGGGSGAGATSGGDDLGANDELIPFQDEGGEEQEPSSDSASAQRDL
DEVKSSLVNESENQSSSSDSEAERRPQPARDAFQKPRDYFAEVRRPQDGAFFKGPAYPGY
PFLMIPDLSSPYLSNGPLSPGGARTYLQMKWPLLDVPSSATVKDTRSPSPAHLSNKVPVV
QHPHHMHPLTPLITYSNDHFSPASPPTHLSPEIDPKTGIPRPPHPSELSPYYPLSPGAVG
QIPHPLGWLVPQQGQPMYSLPPGGFRHPYPALAMNASMSSLVSSRFPHMVAPAHPGLPTS
GIPHPAIVSPIVKQEPAAPSLSPAVSAKSPVTVKKEEEKKPHVKKPLNAFMLYMKEMRAK
VVAECTLKESAAINQILGRKWHNLSREEQAKYYELARKERQLHAQLYPTWSARDNYGKKK
KRKREKQLSQTQSQQQIQEAEGALASKSKKPCIQYLPPEKPCDSPASSHGSTLDSPATPS
AALASPAAPAATHSEQAQPLSLTTKPEARAQLALHSAAFLSAKAAASNSSQMGSQPPLLS
RPLPLGSMPAALLTSPPTFPATLHAHQALPVLQAQPLSLVTKSAH
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atgccccagctcggtggtggccgcggtggcggcgccggcgggggaggcggtggctccgga
gccggggcaaccagtggaggggacgacctcggagcgaacgacgagctgatccccttccag
gacgaggggggcgaagagcaagagccgagcagcgacagcgcttcggcgcagagggatctg
gatgaggtcaagtcgtccctggtcaacgaatcggagaatcagagcagtagctcggactcc
gaggcggagaggcgcccgcagcccgcccgggacgctttccagaagccgcgcgactatttc
gccgaagtgagaaggccccaggatggcgctttttttaagggacctgcgtatcctgggtac
cccttcctgatgattccagacctgagcagcccgtacctctccaacggacccctgtctcct
ggtggagcgcgcacctacctacagatgaaatggcccctcctcgatgtcccctccagtgct
acagtcaaggacacaaggtcgccatctccagcacacttgtccaacaaagttcctgttgtt
cagcaccctcatcacatgcacccgctgacacctctcatcacctacagcaacgaccacttc
tcccctgcgtcccctcccacgcatctgtccccagagatcgacccaaagacaggaatcccc
cggccccctcatccatctgagctgtcaccgtattacccactgtctccaggagctgtcgga
caaatcccccatcccctcggctggctcgtcccacagcaagggcagcccatgtactctctc
cctccgggtggtttccggcatccttaccctgccctcgccatgaacgcttcaatgtccagc
ctggtctcaagccggttcccacacatggtggctcctgcccatcctggtctgcccacctca
ggaatcccccaccctgccatcgtctcccccattgtgaagcaggagccagcagcccccagc
ctgagccctgcagtgagtgcgaaatccccagttacggtgaagaaggaagaggagaagaaa
cctcacgtgaaaaagcccctgaatgccttcatgttgtatatgaaggagatgagggccaag
gtggtggccgagtgtaccctgaaggaaagtgcagccattaaccaaatcctgggaagaaag
tggcacaacctgtcaagagaagaacaggccaaatactatgagcttgcccggaaagaacgg
cagcttcacgcgcagctctacccaacctggtcagcccgggacaactatgggaagaagaag
aagaggaagagagaaaagcagctgtcacagacacagtctcagcagcaaatccaagaggca
gagggtgctctggcctctaagagcaagaagccatgcattcagtacctgccccctgagaag
ccttgtgatagccctgcgtcttcccatggcagcacgctggactcccctgcgacgccctcc
gcagccttggcctcaccagctgcccctgcggctacccactccgagcaagcgcagcccctg
tcgctcaccaccaaaccggaggcccgggcccagctggctctccactccgctgccttcctg
tcggctaaggcggccgccagcaactccagccagatgggcagccagcccccactcctatcc
aggcccttgcccttgggctctatgcccgccgctctgctgacctctccccctactttccca
gctacgctccatgcccaccaggccctccccgtgctacaggcccagcctctttccttggtc
accaagtctgcccactaa

KEGG   Mus musculus (mouse): 21416Help
Entry
21416             CDS       T01002                                 

Gene name
Tcf7l2, TCF4B, TCF4E, Tcf-4, Tcf4
Definition
(RefSeq) transcription factor 7 like 2, T cell specific, HMG box
  KO
K04491  transcription factor 7-like 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04310  Wnt signaling pathway
mmu04390  Hippo signaling pathway
mmu04520  Adherens junction
mmu04916  Melanogenesis
mmu04934  Cushing syndrome
mmu05165  Human papillomavirus infection
mmu05200  Pathways in cancer
mmu05210  Colorectal cancer
mmu05213  Endometrial cancer
mmu05215  Prostate cancer
mmu05216  Thyroid cancer
mmu05217  Basal cell carcinoma
mmu05221  Acute myeloid leukemia
mmu05224  Breast cancer
mmu05225  Hepatocellular carcinoma
mmu05226  Gastric cancer
mmu05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    21416 (Tcf7l2)
   04390 Hippo signaling pathway
    21416 (Tcf7l2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    21416 (Tcf7l2)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    21416 (Tcf7l2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    21416 (Tcf7l2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    21416 (Tcf7l2)
   05225 Hepatocellular carcinoma
    21416 (Tcf7l2)
   05226 Gastric cancer
    21416 (Tcf7l2)
   05216 Thyroid cancer
    21416 (Tcf7l2)
   05221 Acute myeloid leukemia
    21416 (Tcf7l2)
   05217 Basal cell carcinoma
    21416 (Tcf7l2)
   05215 Prostate cancer
    21416 (Tcf7l2)
   05213 Endometrial cancer
    21416 (Tcf7l2)
   05224 Breast cancer
    21416 (Tcf7l2)
  09166 Cardiovascular disease
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    21416 (Tcf7l2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    21416 (Tcf7l2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    21416 (Tcf7l2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    21416 (Tcf7l2)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG TCF-1
    21416 (Tcf7l2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CTNNB1_binding HMG_box HMG_box_2
Motif
Other DBs
NCBI-GeneID: 21416
NCBI-ProteinID: NP_001136390
MGI: 1202879
Ensembl: ENSMUSG00000024985
Vega: OTTMUSG00000020410
UniProt: Q924A0 E9QQ91
LinkDB All DBs
Position
19 D2; 19 51.59 cM
AA seq 459 aa AA seqDB search
MPQLNGGGGDDLGANDELISFKDEGEQEEKNSENSSAERDLADVKSSLVNESETNQNSSS
DSEAERRPPPRSESFRDKSRESLEEAAKRQDGGLFKGPPYPGYPFIMIPDLTSPYLPNGS
LSPTARTYLQMKWPLLDVQAGSLQSRQTLKDARSPSPAHIVSNKVPVVQHPHHVHPLTPL
ITYSNEHFTPGNPPPHLPADVDPKTGIPRPPHPPDISPYYPLSPGTVGQIPHPLGWLVPQ
QGQPVYPITTGGFRHPYPTALTVNASMSRFPPHMVPPHHTLHTTGIPHPAIVTPTVKQES
SQSDVGSLHSSKHQDSKKEEEKKKPHIKKPLNAFMLYMKEMRAKVVAECTLKESAAINQI
LGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKKRKRDKQPGETNEHSE
CFLNPCLSLPPITDLSAPKKCRARFGLDQQNNWCGPCSL
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgccgcagctgaacggcggtggaggagatgacctaggcgctaacgacgagctgatctcc
ttcaaagacgaaggcgagcaggaggagaagaactcggaaaactcctcggcggaaagggat
ttagccgatgtcaagtcctcgctggtcaatgaatcagagacgaatcaaaacagctcctcc
gattccgaggcggaaagacggcctccgcctcgctccgaaagtttccgagataaatcccgg
gaaagtttggaagaagcggccaagaggcaagatggagggctctttaaggggccaccgtat
cccggctaccccttcatcatgatccccgacctgacgagcccctacctccccaacggatcg
ctctcgcccaccgcccgaacctatcttcagatgaaatggccactgcttgatgtccaagca
ggaagcctccagagcagacaaaccctcaaggatgctcgttcgccgtcgccagcacacatc
gtttcgaacaaagtaccggtggtgcaacacccccaccatgtccacccactcacgcctctc
atcacgtacagcaatgaacacttcaccccgggaaatccacctccgcacttaccagctgac
gtagaccccaaaacaggaatcccaaggcctccgcaccctccagatatctctccatattac
ccgctgtcgcccggcaccgtaggacaaatcccccatccgctaggatggttagtaccacag
caaggtcagcctgtgtacccaatcacgacaggaggattcagacacccctaccccacagcg
ctgacagtcaacgcatctatgtctaggttccctccccatatggtccctccccatcacact
ctgcacacgaccggcatccctcacccggccatcgtcacaccgacagtcaagcaggaatcc
tcccagagtgacgtcggctcactccacagctcaaagcatcaggactccaaaaaggaagaa
gagaagaagaagccccacataaagaagccccttaatgcattcatgttgtatatgaaagag
atgagagcgaaggtggtggccgaatgcacattgaaagagagtgcagccatcaaccagatt
ctcgggcgcaggtggcacgccctgtccagggaagaacaggcaaaatactacgagctggcc
cggaaggaacgacagcttcacatgcagctgtaccctggctggtctgcacgggataactat
gggaagaagaagaagagaaaaagagacaagcagccgggggaaaccaacgaacacagcgaa
tgtttcctaaatccttgcctttcgcttcctccgatcacagacctgagcgctcctaagaaa
tgccgagcgcgctttggccttgatcaacagaataactggtgcggcccctgcagtctttga

DBGET integrated database retrieval system