KEGG   Mus musculus (mouse): 16873Help
Entry
16873             CDS       T01002                                 

Gene name
Lhx5, Lim2
Definition
(RefSeq) LIM homeobox protein 5
  KO
K18493  LIM homeobox protein 5
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    16873 (Lhx5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    16873 (Lhx5)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain with LIM region
    16873 (Lhx5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LIM Homeodomain Homeobox_KN Furin-like_2
Motif
Other DBs
NCBI-GeneID: 16873
NCBI-ProteinID: NP_032525
MGI: 107792
Ensembl: ENSMUSG00000029595
Vega: OTTMUSG00000039746
UniProt: P61375 Q543P4
LinkDB All DBs
Position
5 F; 5 60.62 cM
AA seq 402 aa AA seqDB search
MMVHCAGCERPILDRFLLNVLDRAWHIKCVQCCECKTNLSEKCFSREGKLYCKNDFFRRF
GTKCAGCAQGISPSDLVRKARSKVFHLNCFTCMVCNKQLSTGEELYVIDENKFVCKDDYL
SSSSLKEGSLNSVSSCTDRSLSPDLQDPLQDDPKETDNSTSSDKETANNENEEQNSGTKR
RGPRTTIKAKQLETLKAAFAATPKPTRHIREQLAQETGLNMRVIQVWFQNRRSKERRMKQ
LSALGARRHAFFRSPRRMRPLGGRLDESEMLGSTPYTYYGDYQSDYYAPGGNYDFFAHGP
PSQAQSPADSSFLAASGPGSTPLGALEPPLAGPHGADNPRFTDMISHPDTPSPEPGLPGA
LHPMPGEVFSGGPSPPFPMSGTSGYSGPLSHPNPELNEAAVW
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgatggtgcactgtgctggctgtgagcggcccatcctcgaccgctttctgctgaacgta
ctagaccgcgcgtggcatatcaaatgtgttcaatgctgcgagtgcaaaaccaacctctcg
gagaagtgcttctcacgggaaggcaagctatactgtaaaaacgactttttcaggcgcttt
ggcacaaagtgcgccggctgcgcgcaaggtatctctccgagcgacctggtacggaaggcc
cggagcaaagtcttccacctcaactgcttcacctgtatggtgtgcaataagcagctatcc
accggagaggagctctacgtgatcgacgagaacaagtttgtgtgcaaggacgactactta
agctcctctagcctcaaggaaggaagtctcaactcggtgtcgtcctgtacggaccgcagt
ttgtccccggacctccaggatccgttacaggacgaccccaaagagaccgacaattcgacc
tcatcggacaaggaaaccgctaacaacgagaatgaggaacagaactccggcaccaaacgg
cgcggcccgcgcaccaccatcaaggccaagcagctggagacgctcaaggcagccttcgca
gccacgcccaagcccacgcgccacattcgcgaacagctggcacaggagacgggcctcaac
atgagggtcattcaggtgtggtttcagaaccgaaggtccaaagaacgccgcatgaaacag
ctgagcgctctgggcgcgcggagacacgccttcttccggagtccgcggcgcatgcgtccc
ctgggcggccgcttggacgagtctgagatgttggggtctaccccatacacttattacgga
gactaccaaagtgactactacgctccgggaggcaattacgatttcttcgcgcacggtccg
ccgtcacaggcgcagtcccctgccgactccagcttcctggcagcatcgggacctggctcg
acgccgctgggcgcgctggaaccgccgctggccgggcctcacggcgcggacaaccccaga
ttcaccgacatgatctcgcatccggacacgccgagccccgagccgggcctgcccggtgcg
ctgcaccccatgccgggagaggtgttcagcggcgggcccagcccgcccttccccatgagc
ggcaccagcggctacagtggacccctgtcgcaccccaaccctgagctcaacgaagcggcc
gtatggtaa

DBGET integrated database retrieval system