KEGG   Mus musculus (mouse): 16973Help
Entry
16973             CDS       T01002                                 

Gene name
Lrp5, BMND1, HBM, LR3, LRP7, OPPG, mKIAA4142
Definition
(RefSeq) low density lipoprotein receptor-related protein 5
  KO
K03068  low density lipoprotein receptor-related protein 5/6
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04150  mTOR signaling pathway
mmu04310  Wnt signaling pathway
mmu04928  Parathyroid hormone synthesis, secretion and action
mmu05200  Pathways in cancer
mmu05224  Breast cancer
mmu05225  Hepatocellular carcinoma
mmu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    16973 (Lrp5)
   04150 mTOR signaling pathway
    16973 (Lrp5)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    16973 (Lrp5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    16973 (Lrp5)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    16973 (Lrp5)
   05226 Gastric cancer
    16973 (Lrp5)
   05224 Breast cancer
    16973 (Lrp5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    16973 (Lrp5)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Low-density lipoprotein receptor (LDLR) family proteins
    16973 (Lrp5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ldl_recept_b FXa_inhibition Ldl_recept_a DUF5050 SGL Insulin_TMD
Motif
Other DBs
NCBI-GeneID: 16973
NCBI-ProteinID: NP_032539
MGI: 1278315
Ensembl: ENSMUSG00000024913
Vega: OTTMUSG00000042195
UniProt: Q91VN0
LinkDB All DBs
Position
19; 19 A
AA seq 1614 aa AA seqDB search
METAPTRAPPPPPPPLLLLVLYCSLVPAAASPLLLFANRRDVRLVDAGGVKLESTIVASG
LEDAAAVDFQFSKGAVYWTDVSEEAIKQTYLNQTGAAAQNIVISGLVSPDGLACDWVGKK
LYWTDSETNRIEVANLNGTSRKVLFWQDLDQPRAIALDPAHGYMYWTDWGEAPRIERAGM
DGSTRKIIVDSDIYWPNGLTIDLEEQKLYWADAKLSFIHRANLDGSFRQKVVEGSLTHPF
ALTLSGDTLYWTDWQTRSIHACNKWTGEQRKEILSALYSPMDIQVLSQERQPPFHTPCEE
DNGGCSHLCLLSPREPFYSCACPTGVQLQDNGKTCKTGAEEVLLLARRTDLRRISLDTPD
FTDIVLQVGDIRHAIAIDYDPLEGYVYWTDDEVRAIRRAYLDGSGAQTLVNTEINDPDGI
AVDWVARNLYWTDTGTDRIEVTRLNGTSRKILVSEDLDEPRAIVLHPVMGLMYWTDWGEN
PKIECANLDGRDRHVLVNTSLGWPNGLALDLQEGKLYWGDAKTDKIEVINIDGTKRKTLL
EDKLPHIFGFTLLGDFIYWTDWQRRSIERVHKVKASRDVIIDQLPDLMGLKAVNVAKVVG
TNPCADGNGGCSHLCFFTPRATKCGCPIGLELLSDMKTCIIPEAFLVFTSRATIHRISLE
TNNNDVAIPLTGVKEASALDFDVSNNHIYWTDVSLKTISRAFMNGSSVEHVIEFGLDYPE
GMAVDWMGKNLYWADTGTNRIEVARLDGQFRQVLVWRDLDNPRSLALDPTKGYIYWTEWG
GKPRIVRAFMDGTNCMTLVDKVGRANDLTIDYADQRLYWTDLDTNMIESSNMLGQERMVI
ADDLPYPFGLTQYSDYIYWTDWNLHSIERADKTSGRNRTLIQGHLDFVMDILVFHSSRQD
GLNDCVHSNGQCGQLCLAIPGGHRCGCASHYTLDPSSRNCSPPSTFLLFSQKFAISRMIP
DDQLSPDLVLPLHGLRNVKAINYDPLDKFIYWVDGRQNIKRAKDDGTQPSMLTSPSQSLS
PDRQPHDLSIDIYSRTLFWTCEATNTINVHRLDGDAMGVVLRGDRDKPRAIAVNAERGYM
YFTNMQDHAAKIERASLDGTEREVLFTTGLIRPVALVVDNALGKLFWVDADLKRIESCDL
SGANRLTLEDANIVQPVGLTVLGRHLYWIDRQQQMIERVEKTTGDKRTRVQGRVTHLTGI
HAVEEVSLEEFSAHPCARDNGGCSHICIAKGDGTPRCSCPVHLVLLQNLLTCGEPPTCSP
DQFACTTGEIDCIPGAWRCDGFPECADQSDEEGCPVCSASQFPCARGQCVDLRLRCDGEA
DCQDRSDEANCDAVCLPNQFRCTSGQCVLIKQQCDSFPDCADGSDELMCEINKPPSDDIP
AHSSAIGPVIGIILSLFVMGGVYFVCQRVMCQRYTGASGPFPHEYVGGAPHVPLNFIAPG
GSQHGPFPGIPCSKSVMSSMSLVGGRGSVPLYDRNHVTGASSSSSSSTKATLYPPILNPP
PSPATDPSLYNVDVFYSSGIPATARPYRPYVIRGMAPPTTPCSTDVCDSDYSTSRWKSSK
YYLDLNSDSDPYPPPPTPHSQYLSAEDSCPPSPGTERSYCHLFPPPPSPCTDSS
NT seq 4845 nt NT seq  +upstreamnt  +downstreamnt
atggaaacggcgccgacccgggcccctccgccgccgccgccgccgctgctgctgctggtg
ctgtactgcagcttggtccccgccgcggcctcaccgctcctgttgtttgccaaccgccgg
gatgtgcggctagtggatgccggcggagtgaagctggagtccaccattgtggccagtggc
ctggaggatgcagctgctgtagacttccagttctccaagggtgctgtgtactggacagat
gtgagcgaggaggccatcaaacagacctacctgaaccagactggagctgctgcacagaac
attgtcatctcgggcctcgtgtcacctgatggcctggcctgtgactgggttggcaagaag
ctgtactggacggactccgagaccaaccgcattgaggttgccaacctcaatgggacgtcc
cgtaaggttctcttctggcaggacctggaccagccaagggccattgccctggatcctgca
catgggtacatgtactggactgactggggggaagcaccccggatcgagcgggcagggatg
gatggcagtacccggaagatcattgtagactccgacatttactggcccaatgggctgacc
atcgacctggaggaacagaagctgtactgggccgatgccaagctcagcttcatccaccgt
gccaacctggacggctccttccggcagaaggtggtggagggcagcctcactcaccctttt
gccctgacactctctggggacacactctactggacagactggcagacccgctccatccac
gcctgcaacaagtggacaggggagcagaggaaggagatccttagtgctctgtactcaccc
atggacatccaagtgctgagccaggagcggcagcctcccttccacacaccatgcgaggag
gacaacggtggctgttcccacctgtgcctgctgtccccgagggagcctttctactcctgt
gcctgccccactggtgtgcagttgcaggacaatggcaagacgtgcaagacaggggctgag
gaagtgctgctgctggctcggaggacagacctgaggaggatctctctggacacccctgac
ttcacagacatagtgctgcaggtgggcgacatccggcatgccattgccattgactacgat
cccctggagggctacgtgtactggaccgacgatgaggtgcgggctatccgcagggcgtac
ctagatggctcaggtgcgcagacacttgtgaacactgagatcaatgaccccgatggcatt
gctgtggactgggtcgcccggaacctctactggacagatacaggcactgacagaattgag
gtgactcgcctcaacggcacctcccgaaagatcctggtatctgaggacctggacgaaccg
cgagccattgtgttgcaccctgtgatgggcctcatgtactggacagactggggggagaac
cccaaaatcgaatgcgccaacctagatgggagagatcggcatgtcctggtgaacacctcc
cttgggtggcccaacggactggccctggacctgcaggagggcaagctgtactggggggat
gccaaaactgataaaatcgaggtgatcaacatagatgggacaaagcggaagaccctgctt
gaggacaagctcccacatatttttgggttcacactgctgggggacttcatctactggacc
gactggcagagacgcagtattgaaagggtccacaaggtcaaggccagccgggatgtcatc
attgatcaactccccgacctgatgggactcaaagctgtgaatgtggccaaggttgtcgga
accaacccatgtgcggatggaaatggagggtgcagccatctgtgcttcttcaccccacgt
gccaccaagtgtggctgccccattggcctggagctgttgagtgacatgaagacctgcata
atccccgaggccttcctggtattcaccagcagagccaccatccacaggatctccctggag
actaacaacaacgatgtggctatcccactcacgggtgtcaaagaggcctctgcactggac
tttgatgtgtccaacaatcacatctactggactgatgtcagcctcaagacgatcagccga
gccttcatgaatgggagctcagtggagcacgtgattgagtttggcctcgactaccctgaa
ggaatggctgtggactggatgggcaagaacctctattgggcggacacagggaccaacagg
attgaggtggcccggctggatgggcagttccggcaggtgcttgtgtggagagaccttgac
aaccccaggtctctggctctggatcctactaaaggctacatctactggactgagtggggt
ggcaagccaaggattgtgcgggccttcatggatgggaccaattgtatgacactggtagac
aaggtgggccgggccaacgacctcaccattgattatgccgaccagcgactgtactggact
gacctggacaccaacatgattgagtcttccaacatgctgggtcaggagcgcatggtgata
gctgacgatctgccctacccgtttggcctgactcaatatagcgattacatctactggact
gactggaacctgcatagcattgaacgggcggacaagaccagtgggcggaaccgcaccctc
atccagggtcacctggacttcgtcatggacatcctggtgttccactcctcccgtcaggat
ggcctcaacgactgcgtgcacagcaatggccagtgtgggcagctgtgcctcgccatcccc
ggaggccaccgctgtggctgtgcttcacactacacgctggaccccagcagccgcaactgc
agcccgccctccaccttcttgctgttcagccagaaatttgccatcagccggatgatcccc
gatgaccagctcagcccggaccttgtcctaccccttcatgggctgaggaacgtcaaagcc
atcaactatgacccgctggacaagttcatctactgggtggacgggcgccagaacatcaag
agggccaaggacgacggtacccagccctccatgctgacctctcccagccaaagcctgagc
ccagacagacagccacacgacctcagcattgacatctacagccggacactgttctggacc
tgtgaggccaccaacactatcaatgtccaccggctggatggggatgccatgggagtggtg
cttcgaggggaccgtgacaagccaagggccattgctgtcaatgctgagcgagggtacatg
tactttaccaacatgcaggaccatgctgccaagatcgagcgagcctccctggatggcaca
gagcgggaggtcctcttcaccacaggcctcatccgtcccgtggcccttgtggtggacaat
gctctgggcaagctcttctgggtggatgccgacctaaagcgaatcgaaagctgtgacctc
tctggggccaaccgcctgaccctggaagatgccaacatcgtacagccagtaggtctgaca
gtgctgggcaggcacctctactggatcgaccgccagcagcagatgatcgagcgcgtggag
aagaccactggggacaagcggactagggttcagggccgtgtcacccacctgacaggcatc
catgccgtggaggaagtcagcctggaggagttctcagcccatccttgtgcccgagacaat
ggcggctgctcccacatctgtatcgccaagggtgatggaacaccgcgctgctcgtgccct
gtccacctggtgctcctgcagaacctgctgacttgtggtgagcctcctacctgctcccct
gatcagtttgcatgtaccactggtgagatcgactgcatccccggagcctggcgctgtgac
ggcttccctgagtgtgctgaccagagtgatgaagaaggctgcccagtgtgctccgcctct
cagttcccctgcgctcgaggccagtgtgtggacctgcggttacgctgcgacggtgaggcc
gactgccaggatcgctctgatgaagctaactgcgatgctgtctgtctgcccaatcagttc
cggtgcaccagcggccagtgtgtcctcatcaagcaacagtgtgactccttccccgactgt
gctgatgggtctgatgagctcatgtgtgaaatcaacaagccaccctctgatgacatccca
gcccacagcagtgccattgggcccgtcattggtatcatcctctccctcttcgtcatgggc
ggggtctactttgtctgccagcgtgtgatgtgccagcgctacacaggggccagtgggccc
tttccccacgagtatgttggtggagcccctcatgtgcctctcaacttcatagccccaggt
ggctcacagcacggtcccttcccaggcatcccgtgcagcaagtccgtgatgagctccatg
agcctggtgggggggcgcggcagtgtgcccctctatgaccggaatcacgtcactggggcc
tcatccagcagctcgtccagcacaaaggccacactatatccgccgatcctgaacccaccc
ccgtccccggccacagacccctctctctacaacgtggacgtgttttattcttcaggcatc
ccggccaccgctagaccatacaggccctacgtcattcgaggtatggcacccccaacaaca
ccgtgcagcacagatgtgtgtgacagtgactacagcaccagtcgctggaagagcagcaaa
tactacctggacttgaattcggactcagacccctacccccccccgcccaccccccacagc
cagtacctatctgcagaggacagctgcccaccctcaccaggcactgagaggagttactgc
cacctcttcccgcccccaccgtccccctgcacggactcgtcctga

KEGG   Mus musculus (mouse): 16974Help
Entry
16974             CDS       T01002                                 

Gene name
Lrp6, C030016K15Rik, Cd, Gw, ska26, ska<m26Jus>, skax26
Definition
(RefSeq) low density lipoprotein receptor-related protein 6
  KO
K03068  low density lipoprotein receptor-related protein 5/6
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04150  mTOR signaling pathway
mmu04310  Wnt signaling pathway
mmu04928  Parathyroid hormone synthesis, secretion and action
mmu05200  Pathways in cancer
mmu05224  Breast cancer
mmu05225  Hepatocellular carcinoma
mmu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    16974 (Lrp6)
   04150 mTOR signaling pathway
    16974 (Lrp6)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    16974 (Lrp6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    16974 (Lrp6)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    16974 (Lrp6)
   05226 Gastric cancer
    16974 (Lrp6)
   05224 Breast cancer
    16974 (Lrp6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    16974 (Lrp6)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Low-density lipoprotein receptor (LDLR) family proteins
    16974 (Lrp6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ldl_recept_b FXa_inhibition Ldl_recept_a DUF5050 SGL cEGF EGF
Motif
Other DBs
NCBI-GeneID: 16974
NCBI-ProteinID: NP_032540
MGI: 1298218
Ensembl: ENSMUSG00000030201
Vega: OTTMUSG00000021240
UniProt: O88572 A0A0R4J0A9
LinkDB All DBs
Position
6 G1; 6 65.37 cM
AA seq 1613 aa AA seqDB search
MGAVLRSLLACSFCVLLRAAPLLLYANRRDLRLVDATNGKENATIVVGGLEDAAAVDFVF
GHGLIYWSDVSEEAIKRTEFNKTESVQNVVVSGLLSPDGLACDWLGEKLYWTDSETNRIE
VSNLDGSLRKVLFWQELDQPRAIALDPSSGFMYWTDWGEVPKIERAGMDGSSRFVIINTE
IYWPNGLTLDYQERKLYWADAKLNFIHKSNLDGTNRQAVVKGSLPHPFALTLFEDTLYWT
DWNTHSILACNKYTGEGLREIHSNIFSPMDIHAFSQQRQPNATNPCGIDNGGCSHLCLMS
PVKPFYQCACPTGVKLLENGKTCKDGATELLLLARRTDLRRISLDTPDFTDIVLQLEDIR
HAIAIDYDPVEGYIYWTDDEVRAIRRSFIDGSGSQFVVTAQIAHPDGIAVDWVARNLYWT
DTGTDRIEVTRLNGTMRKILISEDLEEPRAIVLDPMVGYMYWTDWGEIPKIERAALDGSD
RVVLVNTSLGWPNGLALDYDEGTIYWGDAKTDKIEVMNTDGTGRRVLVEDKIPHIFGFTL
LGDYVYWTDWQRRSIERVHKRSAEREVIIDQLPDLMGLKATSVHRIIGSNPCAEDNGGCS
HLCLYRPQGLRCACPIGFELISDMKTCIVPEAFLLFSRRADIRRISLETNNNNVAIPLTG
VKEASALDFDVTDNRIYWTDISLKTISRAFMNGSALEHVVEFGLDYPEGMAVDWLGKNLY
WADTGTNRIEVSKLDGQHRQVLVWKDLDSPRALALDPAEGFMYWTEWGGKPKIDRAAMDG
SERTTLVPNVGRANGLTIDYAKRRLYWTDLDTNLIESSDMLGLNREVIADDLPHPFGLTQ
YQDYIYWTDWSRRSIERANKTSGQNRTIIQGHLDYVMDILVFHSSRQAGWNECASSNGHC
SHLCLAVPVGGFVCGCPAHYSLNADNRTCSAPTTFLLFSQKSAINRMVIDEQQSPDIILP
IHSLRNVRAIDYDPLDKQLYWIDSRQNSIRKAHEDGGQGFNVVANSVANQNLEIQPYDLS
IDIYSRYIYWTCEATNVIDVTRLDGRSVGVVLKGEQDRPRAIVVNPEKGYMYFTNLQERS
PKIERAALDGTEREVLFFSGLSKPIALALDSKLGKLFWADSDLRRIESSDLSGANRIVLE
DSNILQPVGLTVFENWLYWIDKQQQMIEKIDMTGREGRTKVQARIAQLSDIHAVKELNLQ
EYRQHPCAQDNGGCSHICLVKGDGTTRCSCPMHLVLLQDELSCGEPPTCSPQQFTCFTGD
IDCIPVAWRCDGFTECEDHSDELNCPVCSESQFQCASGQCIDGALRCNGDANCQDKSDEK
NCEVLCLIDQFRCANGQCVGKHKKCDHSVDCSDRSDELDCYPTEEPAPQATNTVGSVIGV
IVTIFVSGTIYFICQRMLCPRMKGDGETMTNDYVVHSPASVPLGYVPHPSSLSGSLPGMS
RGKSMISSLSIMGGSSGPPYDRAHVTGASSSSSSSTKGTYFPAILNPPPSPATERSHYTM
EFGYSSNSPSTHRSYSYRPYSYRHFAPPTTPCSTDVCDSDYAPSRRMTSVATAKGYTSDV
NYDSEPVPPPPTPRSQYLSAEENYESCPPSPYTERSYSHHLYPPPPSPCTDSS
NT seq 4842 nt NT seq  +upstreamnt  +downstreamnt
atgggggccgtgctgaggagcctcctggcctgcagcttctgcgtgctgctgagagcggcc
cctttgttgctttatgcaaacagacgggacttgagattggttgatgctacaaatggcaaa
gagaatgcaacgattgtagttggaggcttggaggatgcagctgcggtggactttgtgttt
ggtcatggcttgatatactggagtgatgtcagcgaagaagccattaaacgaacagaattt
aacaaaactgaaagtgtacagaatgttgttgtttctggattattgtccccggatgggctg
gcatgtgattggcttggagaaaaattgtactggacagattctgaaactaatcgtattgaa
gtttctaatttagatggatctttacgaaaagttttattttggcaagagttggatcaaccc
agagctattgccttagatccatcaagtgggttcatgtactggacagactggggagaagtg
ccaaagatagaacgtgctgggatggatggctcaagtcgcttcgttataataaacacagag
atttactggccaaacggactgactctggactatcaggagcggaagctttactgggccgat
gcaaaacttaatttcatccataaatcaaacctggatggaacaaaccggcaggcagtggtt
aaaggttcccttccacatccttttgccttgacgttatttgaggacacattgtactggact
gactggaatacacactctattttggcttgcaacaaatatactggcgagggtctgcgtgaa
attcattctaacatcttctctcccatggatatacatgctttcagccaacagaggcagcca
aatgctacaaatccatgtggaattgataatggtggttgttcccatttgtgtttgatgtct
ccagtcaagcctttttatcagtgtgcttgcccaactggggtcaagctgctggagaatgga
aagacctgcaaagatggtgccactgaactattgctgttagcccgacggacagacttgagg
cgaatttctttggatacacccgattttactgacattgttctgcagttagaagatatccgg
catgccattgccatagactatgaccctgtagaaggctacatatactggacggatgacgaa
gtgagggctatccgtcgctccttcatagatggatctggcagtcagtttgtggtcacggcc
cagattgctcatcctgatggtattgctgttgactgggttgcaaggaacctgtactggaca
gacactggcacggatcgtatagaagtgacaaggctcaatgggaccatgaggaagatcttg
atttcagaggacttagaggagccccgggctatcgtgttagatcccatggttgggtacatg
tattggacagactggggagaaatcccaaaaatagagcgagctgctctggacggatctgac
cgagtagttcttgtcaacacttcccttggttggccaaacggcttagccctggattatgat
gaaggcacaatatactggggagatgccaaaacagacaaaattgaggttatgaataccgat
ggcaccgggaggcgagtgctggtggaagacaagatccctcacatatttgggtttaccttg
ctgggtgactatgtttactggactgactggcagaggcggagcatcgagagagtacacaaa
cggagcgcagagagggaggtcatcatagatcagctgccagacctcatgggactgaaggcc
acaagtgttcacagaatcattggttctaacccctgtgctgaggacaatggaggatgtagc
catctttgcctgtacaggcctcaggggcttcgatgcgcctgtcccattggctttgagctc
atcagtgacatgaagacatgcattgtccccgaggctttccttctgttctcgaggagagcg
gatatcagacgcatatctttggaaacaaacaacaacaatgtggccattcctctcactggt
gtcaaagaagcctctgctttggattttgatgtcacagacaacaggatttactggactgat
atatcactgaagactattagcagagcctttatgaatggcagtgcactggaacatgtggta
gagtttggcttagattatccagaaggcatggcagtggactggcttgggaagaacttatac
tgggcagacacaggaacaaatcgcattgaggtatcgaagttggacggacagcaccgacag
gttttggtatggaaagaccttgacagtcctcgagctctggcactggatcctgctgaaggg
tttatgtattggactgagtggggaggcaagcctaagattgacagggctgctatggatgga
agtgaacgcactacattagttccaaatgtaggccgagcaaatggtctcaccatcgactat
gctaaaaggcggctttactggacagacctggacactaacctaatagaatcctcagatatg
ctcggactcaaccgtgaagttatagcagatgacttgcctcatccttttggcttaactcag
taccaagattacatctactggacagactggagccgacgcagcattgaacgtgccaacaaa
accagtggccaaaaccgcaccatcatccagggccatttggactatgtgatggacatcctg
gtcttccactcttcccggcaggcagggtggaatgagtgtgcctccagcaacgggcactgc
tcccacctctgcttggctgtgcccgtcggaggttttgtgtgtggatgccctgcccactac
tccctgaatgctgacaacaggacctgcagtgctcccaccaccttcctgctcttcagtcag
aagagcgccatcaaccgcatggtgattgatgaacaacagagccctgacatcatccttcct
atccacagccttcggaacgtccgggccattgactatgaccctttggacaagcagctctac
tggattgactctcgacaaaactccatacgaaaggcacatgaagatggtggccagggtttt
aatgtagttgcaaactcagtcgcaaatcagaaccttgaaatacagccctatgatctcagc
attgatatttatagccgttacatctactggacctgtgaagctaccaatgtcattgatgtg
acgagattagatggacgatcagttggagtggttctaaaaggcgagcaagacagacctcga
gccattgtggtaaaccccgagaaagggtatatgtattttaccaatcttcaggaaagatct
cctaaaattgaacgggctgcattggatggtacagaacgagaggtcctctttttcagtggc
ttaagtaaaccaattgctttggctcttgatagcaagctgggcaagctcttctgggctgac
tcagatctccggcgaattgaaagcagtgatctctcaggtgccaacaggatcgtgctagaa
gactctaatatattacagcctgtgggcctgaccgtgtttgaaaactggctctattggatt
gataaacagcagcagatgattgaaaaaattgacatgactggtcgagaaggaagaaccaag
gtccaggctcgaattgctcagctgagtgacatccatgcagtaaaggagctgaaccttcag
gagtacagacagcacccttgtgcccaggataatggtggctgttcacatatctgccttgta
aaaggagatggtacgacaagatgctcctgccccatgcacttagttctgcttcaggatgag
ctgtcctgtggagagcctccaacgtgttctcctcagcagtttacctgcttcactggggac
attgactgcatccctgtggcttggcggtgtgatgggttcactgagtgcgaagaccacagc
gatgaactcaattgtcccgtgtgctcagagtctcagttccagtgtgccagcgggcagtgc
attgatggtgcccttcgatgcaatggcgatgcgaactgccaggacaaatcagatgagaag
aactgtgaagtgctttgtttaattgatcagttccgctgtgccaatggtcagtgcgttgga
aagcacaagaaatgtgaccacagtgtggactgcagtgacagatctgacgagctggactgt
tatccaactgaggagccagcaccacaagccaccaacacagttggttctgttattggagta
attgtcaccatttttgtgtctggaaccatatactttatctgccagaggatgctgtgtcct
cgtatgaagggagacggggagaccatgactaacgactatgtggttcacagcccggcgtct
gtgccccttggttatgttcctcacccaagctctctctctggatctcttccaggaatgtct
cgaggcaaatcaatgatcagttccctcagtatcatggggggaagcagtgggcccccctat
gatcgagcgcacgtcacgggagcctcctcaagcagttcttccagtaccaaaggcacttac
ttccctgcaattttgaacccaccaccatcgcctgccacagaaagatcccattataccatg
gaatttggttattcttccaacagtccttccacacataggtcctacagctataggccgtac
agctaccggcactttgcaccgcccaccacaccctgcagcactgatgtctgtgacagtgac
tatgctcctagccggaggatgacctcggtggcaacagccaagggctacaccagtgacgtg
aactatgactcagaacctgtgcccccaccgcccacaccccgaagccagtacttgtcagcg
gaggagaactatgaaagctgccccccttccccatacacggagaggagttactcccaccac
ctctacccgccaccaccctccccctgcacggactcctcctga

DBGET integrated database retrieval system