KEGG   Mus musculus (mouse): 16985Help
Entry
16985             CDS       T01002                                 

Gene name
Lsp1, Lsp-1, WP34, p50, pp52
Definition
(RefSeq) lymphocyte specific 1
  KO
K14957  lymphocyte-specific protein 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04625  C-type lectin receptor signaling pathway
mmu05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    16985 (Lsp1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    16985 (Lsp1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Caldesmon
Motif
Other DBs
NCBI-GeneID: 16985
NCBI-ProteinID: NP_001129543
MGI: 96832
Ensembl: ENSMUSG00000018819
Vega: OTTMUSG00000018784
UniProt: P19973
LinkDB All DBs
Position
7 F5; 7 87.93 cM
AA seq 330 aa AA seqDB search
MAEAAIDPRCEEQEELHAEDSEGLTTQWREEDEEEAAREQRQRERERQLQDQDKDKEDDG
GHSLEQPGQQTLISLKSSELDEDEGFGDWSQKPEPRQQFWGNEGTAEGTEPSQSERPEEK
QTEESSHQAKVHLEESNLSYREPDPEDAVGGSGEAEEHLIRHQVRTPSPLALEDTVELSS
PPLSPTTKLADRTESLNRSIKKSNSVKKSQPTLPISTIDERLQQYTQATESSGRTPKLSR
QPSIELPSMAVASTKTLWETGEVQSQSASKTPSCQDIVAGDMSKKSLWEQKGGSKISSTI
KSTPSGKRYKFVATGHGKYEKVLVDEGSAP
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atggcggaggctgccatcgatcccagatgcgaggaacaggaagagctccatgcagaagac
agcgaagggctcacaactcagtggagagaagaagacgaggaagaggctgcccgtgagcag
cgtcaacgggagcgagagaggcagctacaggaccaggacaaagataaagaagatgatggt
ggccattccctggaacagccaggacagcagacactcatcagcctgaagtcctctgaactg
gatgaagatgagggttttggtgactggtcccaaaagccggagccacggcagcaattctgg
gggaatgaggggactgcagaagggactgaaccctctcaaagcgagagaccagaggagaaa
caaacagaggagagttctcaccaagccaaagtccacttggaggagtcaaacctgagctac
agggagcccgatccagaggatgctgttgggggttctggggaggcggaagagcatctgata
cgtcatcaggtcaggacccccagccctttggccttagaagacaccgttgagctgagttca
cctcccctgagccctaccaccaaactggctgataggaccgagtccctgaaccgctccatt
aaaaagagcaacagtgtgaagaagtctcaaccaaccttgcccatttccacaattgatgaa
cgcctgcagcagtatacccaggccactgagtcttctggccgaactcctaagctgtcccgc
cagccctccatagagctgcccagcatggccgtagccagtaccaagactctttgggaaaca
ggagaagtgcagagtcagtctgcttctaagacaccctcctgccaggatatagtagctgga
gacatgagcaagaaaagtctgtgggagcagaaaggaggctccaagatctcatccaccatc
aagagcaccccatctggaaagcggtacaagttcgtggccactggacatgggaagtacgag
aaagtacttgtggatgagggctcagcaccatag

DBGET integrated database retrieval system