KEGG   Mus musculus (mouse): 16992Help
Entry
16992             CDS       T01002                                 

Gene name
Lta, LT, LT-[a], LT-alpha, LT[a], LTalpha, Ltx, TNF-beta, TNFSF1, Tnfb, Tnfsf1b, Tnlg1e, hlb382
Definition
(RefSeq) lymphotoxin A
  KO
K05468  lymphotoxin alpha (TNF superfamily, member 1)
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04061  Viral protein interaction with cytokine and cytokine receptor
mmu04064  NF-kappa B signaling pathway
mmu04668  TNF signaling pathway
mmu04940  Type I diabetes mellitus
mmu05166  Human T-cell leukemia virus 1 infection
mmu05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    16992 (Lta)
   04668 TNF signaling pathway
    16992 (Lta)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    16992 (Lta)
   04061 Viral protein interaction with cytokine and cytokine receptor
    16992 (Lta)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    16992 (Lta)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    16992 (Lta)
   05168 Herpes simplex virus 1 infection
    16992 (Lta)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    16992 (Lta)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  Tumor necrosis fators
   16992 (Lta)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TNF
Motif
Other DBs
NCBI-GeneID: 16992
NCBI-ProteinID: NP_034865
MGI: 104797
Ensembl: ENSMUSG00000024402
Vega: OTTMUSG00000037197
UniProt: P09225 Q542S2
LinkDB All DBs
Position
17 B1; 17 18.59 cM
AA seq 202 aa AA seqDB search
MTLLGRLHLLRVLGTPPVFLLGLLLALPLGAQGLSGVRFSAARTAHPLPQKHLTHGILKP
AAHLVGYPSKQNSLLWRASTDRAFLRHGFSLSNNSLLIPTSGLYFVYSQVVFSGESCSPR
AIPTPIYLAHEVQLFSSQYPFHVPLLSAQKSVYPGLQGPWVRSMYQGAVFLLSKGDQLST
HTDGISHLHFSPSSVFFGAFAL
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgacactgctcggccgtctccacctcttgagggtgcttggcacccctcctgtcttcctc
ctggggctgctgctggccctgcctctaggggcccagggactctctggtgtccgcttctcc
gctgccaggacagcccatccactccctcagaagcacttgacccatggcatcctgaaacct
gctgctcaccttgttgggtaccccagcaagcagaactcactgctctggagagcaagcacg
gatcgtgcctttctccgacatggcttctctttgagcaacaactccctcctgatccccacc
agtggcctctactttgtctactcccaggtggttttctctggagaaagctgctcccccagg
gccattcccactcccatctacctggcacacgaggtccagctcttttcctcccaatacccc
ttccatgtgcctctcctcagtgcgcagaagtctgtgtatccgggacttcaaggaccgtgg
gtgcgctcaatgtaccagggggctgtgttcctgctcagtaagggagaccagctgtccacc
cacaccgacggcatctcccatctacacttcagccccagcagtgtattctttggagccttt
gcactgtag

DBGET integrated database retrieval system