KEGG   Mus musculus (mouse): 16994Help
Entry
16994             CDS       T01002                                 

Gene name
Ltb, AI662801, LTbeta, Tnfc, Tnfsf3, Tnlg1c, p33
Definition
(RefSeq) lymphotoxin B
  KO
K03157  lymphotoxin beta (TNF superfamily, member 3)
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04064  NF-kappa B signaling pathway
mmu05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    16994 (Ltb)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    16994 (Ltb)
 09160 Human Diseases
  09163 Immune disease
   05323 Rheumatoid arthritis
    16994 (Ltb)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    16994 (Ltb)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  Tumor necrosis fators
   16994 (Ltb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TNF
Motif
Other DBs
NCBI-GeneID: 16994
NCBI-ProteinID: NP_032544
MGI: 104796
Ensembl: ENSMUSG00000024399
Vega: OTTMUSG00000037195
UniProt: P41155 A0A0U5JAA2
LinkDB All DBs
Position
17 B1; 17 18.59 cM
AA seq 306 aa AA seqDB search
MGTRGLQGLGGRPQGRGCLLLAVAGATSLVTLLLAVPITVLAVLALVPQDQGRRVEKIIG
SGAQAQKRLDDSKPSCILPSPSSLSETPDPRLHPQRSNASRNLASTSQGPVAQSSREASA
WMTILSPAADSTPDPGVQQLPKGEPETDLNPELPAAHLIGAWMSGQGLSWEASQEEAFLR
SGAQFSPTHGLALPQDGVYYLYCHVGYRGRTPPAGRSRARSLTLRSALYRAGGAYGRGSP
ELLLEGAETVTPVVDPIGYGSLWYTSVGFGGLAQLRSGERVYVNISHPDMVDYRRGKTFF
GAVMVG
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggggacacggggactgcagggcctgggtgggagaccccaggggaggggctgcctcttg
ctggctgtggcaggagctacttccctggtgaccctgttgttggcagtgcctatcactgtc
ctggctgtgctggccttggtgccgcaggatcagggacgtcgggttgagaagatcattggc
tcaggagcacaggctcagaaaagactggatgacagcaaaccgtcgtgcatcttgccctca
ccctctagcctctcagagactcctgacccccgtctgcatcctcagagatccaatgcttcc
aggaatctagcctccacatcccagggccctgttgcgcagtcctctcgggaggcatctgca
tggatgaccatcctgtctccagctgcggattctacaccagatccaggggttcaacagctg
ccaaagggggaaccagaaactgacctcaaccctgagctccctgctgcccacctcataggc
gcttggatgagtgggcaagggctcagctgggaggcgagccaagaagaagcgtttctgagg
agcggcgcgcagttctcccccacccacgggctggcgctgccacaggacggcgtctattac
ctctactgccacgtcgggtacaggggcaggacgccccctgccggccgaagccgtgctcgc
tcgctcacgctgcgcagcgccctgtaccgcgcggggggcgcctacgggcgaggttccccc
gagttgctgctggagggcgcggagacagtcacacctgttgtggaccccatcgggtacggg
tcgttatggtacacgagcgtggggttcggcggcctggcgcagctccggagcggcgagagg
gtctacgttaacatcagtcaccccgacatggtggactacaggagagggaagaccttcttc
ggggcggtgatggtggggtga

DBGET integrated database retrieval system