KEGG   Mus musculus (mouse): 17000Help
Entry
17000             CDS       T01002                                 

Gene name
Ltbr, AI256028, LTbetaR, Ltar, TNF-R-III, TNFCR, TNFR-RP, TNFR2-RP, TNFRrp, Tnfbr, Tnfrsf3
Definition
(RefSeq) lymphotoxin B receptor
  KO
K03159  lymphotoxin beta receptor TNFR superfamily member 3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04061  Viral protein interaction with cytokine and cytokine receptor
mmu04064  NF-kappa B signaling pathway
mmu04066  HIF-1 signaling pathway
mmu04672  Intestinal immune network for IgA production
mmu05166  Human T-cell leukemia virus 1 infection
mmu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    17000 (Ltbr)
   04066 HIF-1 signaling pathway
    17000 (Ltbr)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    17000 (Ltbr)
   04061 Viral protein interaction with cytokine and cytokine receptor
    17000 (Ltbr)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    17000 (Ltbr)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    17000 (Ltbr)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    17000 (Ltbr)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mmu04050]
    17000 (Ltbr)
Cytokine receptors [BR:mmu04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   17000 (Ltbr)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TNFR_c6
Motif
Other DBs
NCBI-GeneID: 17000
NCBI-ProteinID: NP_034866
MGI: 104875
Ensembl: ENSMUSG00000030339
Vega: OTTMUSG00000034580
UniProt: P50284 B2RRV3
LinkDB All DBs
Position
6 F3; 6 59.32 cM
AA seq 415 aa AA seqDB search
MRLPRASSPCGLAWGPLLLGLSGLLVASQPQLVPPYRIENQTCWDQDKEYYEPMHDVCCS
RCPPGEFVFAVCSRSQDTVCKTCPHNSYNEHWNHLSTCQLCRPCDIVLGFEEVAPCTSDR
KAECRCQPGMSCVYLDNECVHCEEERLVLCQPGTEAEVTDEIMDTDVNCVPCKPGHFQNT
SSPRARCQPHTRCEIQGLVEAAPGTSYSDTICKNPPEPGAMLLLAILLSLVLFLLFTTVL
ACAWMRHPSLCRKLGTLLKRHPEGEESPPCPAPRADPHFPDLAEPLLPMSGDLSPSPAGP
PTAPSLEEVVLQQQSPLVQARELEAEPGEHGQVAHGANGIHVTGGSVTVTGNIYIYNGPV
LGGTRGPGDPPAPPEPPYPTPEEGAPGPSELSTPYQEDGKAWHLAETETLGCQDL
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgcgcctgccccgggcctcctctccctgcggcctggcctgggggccactcctgctggga
ctcagcgggcttctggtggcctctcagccccagctggtgcccccttatcgcatagaaaac
cagacttgctgggaccaggacaaggaatactacgagcccatgcacgacgtctgctgctcc
cgctgtcccccaggcgagtttgtctttgcggtatgcagccgcagccaagacacggtttgc
aagacttgcccccataattcctataatgaacactggaaccatctctccacctgccagctg
tgccgcccctgtgacattgtgctgggctttgaggaggttgccccttgcaccagcgatcgg
aaagccgagtgccgctgtcagccggggatgtcctgtgtgtatctggacaatgagtgtgtg
cactgtgaggaggagcggcttgtactctgccagcctggcacagaagccgaggtcacagat
gaaattatggatactgacgtcaactgtgtcccctgtaagccgggacacttccagaacact
tcctcccctcgagcccgctgtcaaccccataccagatgtgagatccagggcctggtggag
gcagctccaggtacctcctactcggataccatctgtaaaaatcccccagagccaggagca
atgctactgctggccatcctgctgtcgctggtcctctttctgctcttcaccactgtcctg
gcctgtgcctggatgaggcacccgtctctctgcagaaagctgggtactctgctcaagcgg
cacccagagggagaagaatctcccccttgccccgctccaagagccgacccacatttccct
gacctggcagagccactcctacccatgtctggagacttgtccccatcccctgctggaccc
ccaacggccccctccttggaggaagtggtgctacaacagcagagtcccctggtccaggcc
agagagctggaggctgaacctggggaacatggccaggtggcccacggtgcgaatggcatt
catgtgaccgggggctctgtgactgtcaccggcaacatctacatatacaatgggccagtg
ctggggggaacacggggccctggagaccctccagctccccctgagcctccataccccact
cctgaagagggagctcctggcccttctgagctgtctacaccctaccaggaggatggcaaa
gcttggcatctggccgagacagagacactaggatgccaagacctctga

DBGET integrated database retrieval system