KEGG   Mus musculus (mouse): 170770Help
Entry
170770            CDS       T01002                                 

Gene name
Bbc3, PUMA, PUMA/JFY1
Definition
(RefSeq) BCL2 binding component 3
  KO
K10132  Bcl-2-binding component 3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01524  Platinum drug resistance
mmu04115  p53 signaling pathway
mmu04210  Apoptosis
mmu04215  Apoptosis - multiple species
mmu04390  Hippo signaling pathway
mmu05016  Huntington disease
mmu05162  Measles
mmu05200  Pathways in cancer
mmu05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    170770 (Bbc3)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    170770 (Bbc3)
   04215 Apoptosis - multiple species
    170770 (Bbc3)
   04115 p53 signaling pathway
    170770 (Bbc3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    170770 (Bbc3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    170770 (Bbc3)
  09164 Neurodegenerative disease
   05016 Huntington disease
    170770 (Bbc3)
  09172 Infectious disease: viral
   05162 Measles
    170770 (Bbc3)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    170770 (Bbc3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PUMA
Motif
Other DBs
NCBI-GeneID: 170770
NCBI-ProteinID: NP_573497
MGI: 2181667
Ensembl: ENSMUSG00000002083
Vega: OTTMUSG00000022267
UniProt: Q99ML1 B2RVL4
LinkDB All DBs
Structure
PDB: 

Position
7; 7 A2
AA seq 193 aa AA seqDB search
MARARQEGSSPEPVEGLARDSPRPFPLGRLMPSAVSCSLCEPGLPAAPAAPALLPAAYLC
APTAPPAVTAALGGPRWPGGHRSRPRGPRPDGPQPSLSPAQQHLESPVPSAPEALAGGPT
QAAPGVRVEEEEWAREIGAQLRRMADDLNAQYERRRQEEQHRHRPSPWRVMYNLFMGLLP
LPRDPGAPEMEPN
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggcccgcgcacgccaggagggcagctctccggagcccgtagagggtctagcccgcgac
agtccgcgccccttcccgctcggccgcctgatgccctccgctgtatcctgcagcctttgc
gagcccggcctgcccgccgcccctgctgcccctgccttgctgccggccgcctacctctgc
gcccccaccgctccacctgccgtcaccgccgccctggggggcccccgctggcctgggggt
caccgcagccggcccagaggcccgcgcccggacggtcctcagccctccctgtcaccagcc
cagcagcacttagagtcgcccgtgcccagcgccccggaggccctggcaggaggccccacc
caagctgccccgggagtgcgtgtggaggaggaggagtgggcccgggagatcggggcccag
ctgcggcggatggcggacgacctcaacgcgcagtacgagcggcggagacaagaagagcag
catcgacaccgaccctcaccctggagggtcatgtacaatctcttcatgggactcctcccc
ttacccagggatcctggagccccagaaatggagcccaactag

DBGET integrated database retrieval system