KEGG   Mus musculus (mouse): 171211Help
Entry
171211            CDS       T01002                                 

Gene name
Edaradd, 1810032E07Rik, 5830469M23Rik, A630043P06, cr
Definition
(RefSeq) EDAR (ectodysplasin-A receptor)-associated death domain
  KO
K23324  ectodysplasin-A receptor-associated adapter protein
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04064  NF-kappa B signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    171211 (Edaradd)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Death
Motif
Other DBs
NCBI-GeneID: 171211
NCBI-ProteinID: NP_598398
MGI: 1931001
Ensembl: ENSMUSG00000095105
UniProt: Q5D0F1
LinkDB All DBs
Position
13 A1; 13 4.77 cM
AA seq 208 aa AA seqDB search
MASPDDPLRSDHMAKEPVEDTDPSTLSFAMSDKYPIQDTGLPKAKECDTVNSNCPPNSDD
QPQGEENDFPDSTKDPLSGVSRNQPCKDGKGSCSCPSCSPRAPTISDLLNDQDLLDTIRI
KLDPCHPTVKNWRNFASKWGMPYDELCFLEQRPQSPTLEFLFRNSQRTVGQLMELCRLYH
RADVEKILRRWVDEEWPHRGHSDSSMHF
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atggcttctccggacgaccctctgcgctcagatcacatggcaaaggagccagtggaggac
acggaccccagcactttatcctttgccatgtcagacaagtatcccattcaagacaccggc
ctccctaaagctaaagagtgtgatacagtcaattccaactgtccaccaaattctgatgac
caacctcagggagaagaaaatgactttccagacagcaccaaagatcccctttcaggtgtc
agcagaaaccagccctgtaaggacgggaagggcagctgctcttgcccttcctgctccccc
cgggcccccaccatcagcgacttgctcaacgatcaggacttgctagatacgatcaggata
aagctggatccatgtcacccaaccgtgaagaactggaggaattttgccagcaaatggggc
atgccctatgatgaactgtgcttcctggaacagaggccccagagccccacgctggagttc
ttattccgaaacagccagaggactgtgggccaactgatggagctctgccggctgtaccac
agggccgatgtggagaagatcctgcgcaggtgggtggatgaggagtggccccaccgggga
cactccgacagctccatgcacttctag

DBGET integrated database retrieval system