KEGG   Mus musculus (mouse): 17125Help
Entry
17125             CDS       T01002                                 

Gene name
Smad1, AI528653, Mad1, Madh1, Madr1, Mlp1, MusMLP, dwf-A, mMad1
Definition
(RefSeq) SMAD family member 1
  KO
K04676  mothers against decapentaplegic homolog 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04350  TGF-beta signaling pathway
mmu04390  Hippo signaling pathway
mmu04550  Signaling pathways regulating pluripotency of stem cells
mmu05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    17125 (Smad1)
   04390 Hippo signaling pathway
    17125 (Smad1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    17125 (Smad1)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    17125 (Smad1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MH2 MH1 IRF-3 DUF4223
Motif
Other DBs
NCBI-GeneID: 17125
NCBI-ProteinID: NP_032565
MGI: 109452
Ensembl: ENSMUSG00000031681
Vega: OTTMUSG00000021109
UniProt: P70340
LinkDB All DBs
Structure
PDB: 

Position
8; 8 C1
AA seq 465 aa AA seqDB search
MNVTSLFSFTSPAVKRLLGWKQGDEEEKWAEKAVDALVKKLKKKKGAMEELEKALSCPGQ
PSNCVTIPRSLDGRLQVSHRKGLPHVIYCRVWRWPDLQSHHELKPLECCEFPFGSKQKEV
CINPYHYKRVESPVLPPVLVPRHSEYNPQHSLLAQFRNLGQNEPHMPLNATFPDSFQQPN
SHPFPHSPNSSYPNSPGGSSSTYPHSPTSSDPGSPFQMPADTPPPAYLPPEDPMAQDGSQ
PMDTNMMAPPLPAEISRGDVQAVAYEEPKHWCSIVYYELNNRVGEAFHASSTSVLVDGFT
DPSNNKNRFCLGLLSNVNRNSTIENTRRHIGKGVHLYYVGGEVYAECLSDSSIFVQSRNC
NYHHGFHPTTVCKIPSGCSLKIFNNQEFAQLLAQSVNHGFETVYELTKMCTIRMSFVKGW
GAEYHRQDVTSTPCWIEIHLHGPLQWLDKVLTQMGSPHNPISSVS
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtgaccagcttgttttcattcacaagtccagctgtgaagagactccttgggtgg
aaacagggcgatgaagaagagaaatgggcagagaaagctgtggacgctttggtgaagaaa
ctgaagaagaagaaaggggccatggaagagctggagaaggccctgagctgccctggacag
ccgagtaactgcgtcaccattcctcgctccctggatggcaggttgcaggtgtcccaccgg
aagggactacctcatgtcatttattgccgtgtgtggcgctggcccgacctccagagccac
catgaactgaagcctctggaatgctgtgagttcccatttggttccaagcagaaggaggtc
tgcatcaacccctaccactataagcgagtggagagcccggttctcccgccggtgctggtt
ccgaggcacagcgagtacaatcctcagcacagccttctggctcagttccgcaacctggga
caaaatgagcctcacatgccactgaacgccacgttcccagactctttccagcagcccaac
agccacccgttcccccactcccccaacagcagctaccccaactctcctggcggcagcagc
agcacctaccctcactccccaaccagctcagacccgggcagcccttttcagatgccagct
gacacacccccacctgcttacctgcctcctgaagaccccatggcccaggatggctctcag
cccatggacacgaacatgatggcgcctccactgcccgctgaaatcagcagaggagatgtt
caggcagttgcttacgaggaaccaaaacactggtgctctattgtgtactatgagctcaac
aaccgtgtgggtgaagcgttccacgcctcgtccaccagcgtgctggtggatggtttcaca
gatccgtccaacaataagaaccgcttctgccttggcttgctctccaacgttaaccggaat
tccactattgaaaacaccaggcgacatattgggaaaggagtccacctttattacgttgga
ggagaggtgtatgcggaatgcctcagtgacagcagcatcttcgtgcagagccggaactgc
aactaccaccacggctttcaccccaccaccgtctgcaagatccccagcgggtgcagcttg
aaaatcttcaacaaccaagagtttgctcagctactggcgcagtctgtgaaccacgggttc
gagaccgtgtatgaactcaccaaaatgtgcactattcggatgagcttcgtgaagggttgg
ggagccgaataccaccggcaggatgttaccagcaccccctgctggattgagatccatctg
catggccctctccagtggctggataaggttctgacccagatgggctcaccccacaatcct
atttcatccgtgtcttaa

KEGG   Mus musculus (mouse): 17129Help
Entry
17129             CDS       T01002                                 

Gene name
Smad5, 1110051M15Rik, AI451355, Dwf-C, Madh5, MusMLP
Definition
(RefSeq) SMAD family member 5
  KO
K16790  mothers against decapentaplegic homolog 5
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04350  TGF-beta signaling pathway
mmu04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    17129 (Smad5)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    17129 (Smad5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MH2 MH1 IRF-3
Motif
Other DBs
NCBI-GeneID: 17129
NCBI-ProteinID: NP_001157513
MGI: 1328787
Ensembl: ENSMUSG00000021540
Vega: OTTMUSG00000020956
UniProt: P97454
LinkDB All DBs
Structure
PDB: 

Position
13 B1; 13 30.12 cM
AA seq 465 aa AA seqDB search
MTSMASLFSFTSPAVKRLLGWKQGDEEEKWAEKAVDALVKKLKKKKGAMEELEKALSSPG
QPSKCVTIPRSLDGRLQVSHRKGLPHVIYCRVWRWPDLQSHHELKPLDICEFPFGSKQKE
VCINPYHYKRVESPVLPPVLVPRHNEFNPQHSLLVQFRNLSHNEPHMPQNATFPDSFHQP
NNAPFPLSPNSPYPPSPASSTYPNSPASSGPGSPFQLPADTPPPAYMPPDDQMAPDNSQP
MDTSSNMIPQTMPSISSRDVQPVAYEEPKHWCSIVYYELNNRVGEAFHASSTSVLVDGFT
DPSNNKSRFCLGLLSNVNRNSTIENTRRHIGKGVHLYYVGGEVYAECLSDSSIFVQSRNC
NFHHGFHPTTVCKIPSSCSLKIFNNQEFAQLLAQSVNHGFEAVYELTKMCTIRMSFVKGW
GAEYHRQDVTSTPCWIEIHLHGPLQWLDKVLTQMGSPLNPISSVS
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgacgtcaatggccagcttgttttctttcactagtccagccgtgaagcgattgttgggc
tggaaacaaggtgacgaggaagagaaatgggcagaaaaggcagtggatgctttagtgaaa
aagctgaagaagaagaagggtgctatggaggagctggagaaagccttgagcagcccagga
cagccaagcaagtgtgtcacgatccccaggtccttggatggacgtctgcaagtttctcac
aggaaaggcttgccccatgttatatattgccgtgtttggcgctggccagatttgcagagc
catcacgagctaaaaccattggatatttgtgaatttccttttggatctaagcaaaaggaa
gtttgtatcaatccataccactataagagagtggagagtccagtcttacctccagtatta
gtgcctcgtcacaatgaattcaatccacaacacagccttctggttcagttcaggaacctg
agccacaatgaaccgcacatgccacaaaacgccacgtttcccgattctttccaccaaccc
aacaacgctcctttccccttatctcctaacagcccctatcctccttcccctgctagcagc
acatatcccaactccccagcaagctctggacctggaagtccatttcaactcccagctgac
acccctccccctgcctatatgccacctgatgatcagatggccccagataattcccagcct
atggatacaagcagtaacatgattcctcagaccatgcccagcatatccagcagagatgtt
cagcctgtcgcctatgaggagcccaaacactggtgttcgattgtctactatgaattaaac
aatcgtgttggggaagcttttcatgcatcttctactagtgtgttagtagatggatttaca
gatccttcaaataacaaaagtagattctgcctgggattgttgtcaaatgttaatcgtaat
tcaactattgaaaacactaggcggcatattggaaaaggtgttcatctatactacgttggt
ggggaggtgtacgctgagtgtcttagtgacagcagcatctttgttcagagtaggaactgc
aactttcaccatggcttccatcccaccaccgtctgtaagatccccagcagctgcagcctc
aagatttttaacaatcaggagtttgctcagcttctggctcagtcagtcaaccatggattc
gaggctgtgtatgagctcaccaagatgtgtaccattcgaatgagctttgtcaagggctgg
ggagcagagtaccaccgacaggacgtcaccagtactccctgctggattgagattcacctc
cacgggcctctgcagtggctggataaagtccttactcagatgggctctccgctgaacccc
atttcttctgtttcatag

KEGG   Mus musculus (mouse): 55994Help
Entry
55994             CDS       T01002                                 

Gene name
Smad9, MADH6, Madh8, Madh9, Smad8
Definition
(RefSeq) SMAD family member 9
  KO
K16791  mothers against decapentaplegic homolog 9
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04350  TGF-beta signaling pathway
mmu04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    55994 (Smad9)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    55994 (Smad9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MH2 MH1 IRF-3 DUF4223
Motif
Other DBs
NCBI-GeneID: 55994
NCBI-ProteinID: NP_062356
MGI: 1859993
Ensembl: ENSMUSG00000027796
Vega: OTTMUSG00000021206
UniProt: Q9JIW5 Q3UVC6
LinkDB All DBs
Position
3; 3 C
AA seq 430 aa AA seqDB search
MHPSTPISSLFSFTSPAVKRLLGWKQGDEEEKWAEKAVDSLVKKLKKKKGAMDELERALS
CPGQPSKCVTIPRSLDGRLQVSHRKGLPHVIYCRVWRWPDLQSHHELKPLECCEFPFGSK
QKEVCINPYHYRRVETPVLPPVLVPRHSEYNPQLSLLAKFRSASLHSEPLMPHNATYPDS
FQQSLCPAPPSSPGHVFPQSPCPTSYPHSPGSPSESDSPYQHSDFRPVCYEEPQHWCSVA
YYELNNRVGETFQASSRSVLIDGFTDPSNNRNRFCLGLLSNVNRNSTIENTRRHIGKGVH
LYYVGGEVYAECVSDSSIFVQSRNCNYQHGFHPATVCKIPSGCSLKVFNNQLFAQLLAQS
VHHGFEVVYELTKMCTIRMSFVKGWGAEYHRQDVTSTPCWIEIHLHGPLQWLDKVLTQMG
SPHNPISSVS
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgcaccccagcacccccatcagctccctcttctccttcaccagccccgcagtgaagcgg
ctgctgggctggaagcagggagatgaagaggagaagtgggcagagaaggcggtggactct
ttggtgaagaagttaaagaagaagaaaggcgccatggatgaactggagagggcgctgagc
tgcccgggtcagcctagcaagtgtgtcaccatcccacggtccctcgatggacgcctccag
gtgtcccaccgaaaggggctgccccacgtcatctactgccgcgtgtggcgctggccagac
ctgcagtcccatcatgagctgaagcccttggagtgctgtgagttcccgttcggctccaag
cagaaggaggtctgcatcaacccataccattaccgcagagtggagaccccagttctgcct
ccagtgctggtaccaagacacagcgagtacaaccctcagctcagcctcctggccaagttc
cgaagtgcctcgctgcacagcgaacccctcatgccgcacaacgccacctaccctgactct
ttccagcagtctctctgtccggcaccgccctcctcgccaggccatgtgtttccgcagtct
ccatgccccaccagctacccgcactcccccggaagtccttccgagtcagacagtccctat
caacactcagacttccggccagtttgctacgaggaaccccagcactggtgttctgttgcc
tactacgaactaaacaaccgggtcggagagactttccaggcgtcctcgcggagcgtgctc
atagacggcttcaccgacccttccaataacaggaataggttctgccttgggcttctctca
aatgtaaacagaaactcgaccatagaaaacaccaggaggcacattggaaagggtgtgcat
ttgtactacgttgggggcgaggtgtatgcggagtgcgtgagcgacagcagcatctttgtc
cagagccggaactgcaactaccagcacggcttccacccggccaccgtctgcaagatcccc
agcggctgcagcctcaaggtcttcaacaaccagctcttcgcccagctgctcgcccagtcc
gtgcaccacggctttgaagtggtgtatgagctgacgaagatgtgcacgattcggatgagc
tttgtgaagggctggggagcagagtatcatcgccaggatgtcacgagcaccccctgctgg
atcgagatccatcttcatggaccgctgcagtggttggataaggtgctcactcagatgggc
tccccacacaaccctatctcttcagtgtcttaa

DBGET integrated database retrieval system