KEGG   Mus musculus (mouse): 17126Help
Entry
17126             CDS       T01002                                 

Gene name
Smad2, 7120426M23Rik, Madh2, Madr2, Smad-2, mMad2
Definition
(RefSeq) SMAD family member 2
  KO
K04500  mothers against decapentaplegic homolog 2/3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04068  FoxO signaling pathway
mmu04110  Cell cycle
mmu04144  Endocytosis
mmu04218  Cellular senescence
mmu04350  TGF-beta signaling pathway
mmu04371  Apelin signaling pathway
mmu04390  Hippo signaling pathway
mmu04520  Adherens junction
mmu04550  Signaling pathways regulating pluripotency of stem cells
mmu04659  Th17 cell differentiation
mmu04926  Relaxin signaling pathway
mmu04933  AGE-RAGE signaling pathway in diabetic complications
mmu05142  Chagas disease (American trypanosomiasis)
mmu05161  Hepatitis B
mmu05166  Human T-cell leukemia virus 1 infection
mmu05200  Pathways in cancer
mmu05205  Proteoglycans in cancer
mmu05210  Colorectal cancer
mmu05212  Pancreatic cancer
mmu05225  Hepatocellular carcinoma
mmu05226  Gastric cancer
mmu05321  Inflammatory bowel disease (IBD)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    17126 (Smad2)
   04390 Hippo signaling pathway
    17126 (Smad2)
   04371 Apelin signaling pathway
    17126 (Smad2)
   04068 FoxO signaling pathway
    17126 (Smad2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    17126 (Smad2)
  09143 Cell growth and death
   04110 Cell cycle
    17126 (Smad2)
   04218 Cellular senescence
    17126 (Smad2)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    17126 (Smad2)
   04550 Signaling pathways regulating pluripotency of stem cells
    17126 (Smad2)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    17126 (Smad2)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    17126 (Smad2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    17126 (Smad2)
   05205 Proteoglycans in cancer
    17126 (Smad2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    17126 (Smad2)
   05212 Pancreatic cancer
    17126 (Smad2)
   05225 Hepatocellular carcinoma
    17126 (Smad2)
   05226 Gastric cancer
    17126 (Smad2)
  09163 Immune disease
   05321 Inflammatory bowel disease (IBD)
    17126 (Smad2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    17126 (Smad2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    17126 (Smad2)
   05161 Hepatitis B
    17126 (Smad2)
  09174 Infectious disease: parasitic
   05142 Chagas disease (American trypanosomiasis)
    17126 (Smad2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MH2 MH1 IRF-3
Motif
Other DBs
NCBI-GeneID: 17126
NCBI-ProteinID: NP_001239410
MGI: 108051
Ensembl: ENSMUSG00000024563
Vega: OTTMUSG00000036536
UniProt: Q62432
LinkDB All DBs
Position
18 E3; 18 51.42 cM
AA seq 467 aa AA seqDB search
MSSILPFTPPVVKRLLGWKKSAGGSGGAGGGEQNGQEEKWCEKAVKSLVKKLKKTGRLDE
LEKAITTQNCNTKCVTIPSTCSEIWGLSTANTVDQWDTTGLYSFSEQTRSLDGRLQVSHR
KGLPHVIYCRLWRWPDLHSHHELKAIENCEYAFNLKKDEVCVNPYHYQRVETPVLPPVLV
PRHTEILTELPPLDDYTHSIPENTNFPAGIEPQSNYIPETPPPGYISEDGETSDQQLNQS
MDTGSPAELSPTTLSPVNHSLDLQPVTYSEPAFWCSIAYYELNQRVGETFHASQPSLTVD
GFTDPSNSERFCLGLLSNVNRNATVEMTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSP
NCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVK
GWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSVRCSSMS
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtccatcttgccattcactccgccagtggtgaagagacttctgggatggaaaaaa
tcagccggtgggtctggaggagcaggtggtggagagcagaatggacaggaagaaaagtgg
tgtgaaaaagcagtgaaaagtctggtgaaaaagctaaagaaaacaggacggttagatgag
cttgagaaagccatcaccactcagaattgcaatactaaatgtgtcaccataccaagcact
tgctctgaaatttggggactgagtacagcaaatacggtagatcagtgggacacaacaggc
ctttacagcttctctgaacaaaccaggtctcttgatggccgtcttcaggtttcacaccgg
aaagggttgccacatgttatatattgccggctctggcgctggccggaccttcacagtcat
catgagctcaaggcaatcgaaaactgcgaatatgcttttaatctgaaaaaagatgaagtg
tgtgtaaatccgtaccactaccagagagttgagaccccagtcttgcctccagtcttagtg
cctcggcacacggagattctaacagaactgccgcccctggatgactacacccactccatt
ccagaaaacacaaatttcccagcaggaattgagccacagagtaattacatcccagaaaca
ccaccacctggatatatcagtgaagatggagaaacaagtgaccaacagttgaaccaaagt
atggacacaggctctccggctgaactgtctcctactactctctctcctgttaatcacagc
ttggatttgcagccagttacttactcggaacctgcattctggtgttcaatcgcatactat
gaactaaaccagagggttggagagaccttccatgcgtcacagccctcgctcactgtagac
ggcttcacagacccatcaaactcggagaggttctgcttaggcttgctctccaacgttaac
cgaaatgccactgtagaaatgacaagaagacatataggaaggggagtgcgcttgtattac
ataggtggggaagtgtttgctgagtgcctaagtgatagtgcaatctttgtgcagagcccc
aactgtaaccagagatacggctggcaccctgcaacagtgtgtaagatcccaccaggctgt
aacctgaagatcttcaacaaccaagaatttgctgctcttctggctcagtctgtcaaccag
ggttttgaagccgtttatcagctaacccgaatgtgcaccataagaatgagttttgtgaag
ggctggggagcagaatatcggaggcagacagtaacaagtactccttgctggattgaactt
catctgaatggccctctgcagtggctggacaaagtattaactcagatgggatccccttca
gtgcgatgctcaagcatgtcgtaa

KEGG   Mus musculus (mouse): 17127Help
Entry
17127             CDS       T01002                                 

Gene name
Smad3, AU022421, Madh3
Definition
(RefSeq) SMAD family member 3
  KO
K04500  mothers against decapentaplegic homolog 2/3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04068  FoxO signaling pathway
mmu04110  Cell cycle
mmu04144  Endocytosis
mmu04218  Cellular senescence
mmu04310  Wnt signaling pathway
mmu04350  TGF-beta signaling pathway
mmu04371  Apelin signaling pathway
mmu04390  Hippo signaling pathway
mmu04520  Adherens junction
mmu04550  Signaling pathways regulating pluripotency of stem cells
mmu04659  Th17 cell differentiation
mmu04926  Relaxin signaling pathway
mmu04933  AGE-RAGE signaling pathway in diabetic complications
mmu05142  Chagas disease (American trypanosomiasis)
mmu05161  Hepatitis B
mmu05166  Human T-cell leukemia virus 1 infection
mmu05200  Pathways in cancer
mmu05210  Colorectal cancer
mmu05212  Pancreatic cancer
mmu05220  Chronic myeloid leukemia
mmu05225  Hepatocellular carcinoma
mmu05226  Gastric cancer
mmu05321  Inflammatory bowel disease (IBD)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    17127 (Smad3)
   04350 TGF-beta signaling pathway
    17127 (Smad3)
   04390 Hippo signaling pathway
    17127 (Smad3)
   04371 Apelin signaling pathway
    17127 (Smad3)
   04068 FoxO signaling pathway
    17127 (Smad3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    17127 (Smad3)
  09143 Cell growth and death
   04110 Cell cycle
    17127 (Smad3)
   04218 Cellular senescence
    17127 (Smad3)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    17127 (Smad3)
   04550 Signaling pathways regulating pluripotency of stem cells
    17127 (Smad3)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    17127 (Smad3)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    17127 (Smad3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    17127 (Smad3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    17127 (Smad3)
   05212 Pancreatic cancer
    17127 (Smad3)
   05225 Hepatocellular carcinoma
    17127 (Smad3)
   05226 Gastric cancer
    17127 (Smad3)
   05220 Chronic myeloid leukemia
    17127 (Smad3)
  09163 Immune disease
   05321 Inflammatory bowel disease (IBD)
    17127 (Smad3)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    17127 (Smad3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    17127 (Smad3)
   05161 Hepatitis B
    17127 (Smad3)
  09174 Infectious disease: parasitic
   05142 Chagas disease (American trypanosomiasis)
    17127 (Smad3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MH2 MH1 IRF-3
Motif
Other DBs
NCBI-GeneID: 17127
NCBI-ProteinID: NP_058049
MGI: 1201674
Ensembl: ENSMUSG00000032402
Vega: OTTMUSG00000021500
UniProt: Q8BUN5
LinkDB All DBs
Position
9; 9 C
AA seq 425 aa AA seqDB search
MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNV
NTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEV
CVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETP
PPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYEL
NQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIG
GEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGF
EAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIR
CSSVS
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtccatcctgcccttcacccccccgatcgtgaagcgcctgctgggttggaagaag
ggcgagcagaacgggcaggaggagaagtggtgcgagaaggcggtcaagagcttggtgaag
aagctcaagaagacggggcagttggacgagctggagaaggccatcaccacgcagaacgtg
aacaccaagtgcattaccatccccaggtcactggatggtcggctgcaggtgtcccatcgg
aaggggctccctcacgttatctactgccgcctgtggcgatggcccgacctgcacagccac
catgaattacgggccatggagctctgtgagtttgccttcaacatgaagaaggatgaagtg
tgtgtaaatccttaccactatcagagagtagagacgccagttctacctccagtgttggtg
ccacgccacaccgagatcccggccgagttccccccactggatgactacagccattccatt
cccgagaacactaacttccctgctggcattgagccccagagcaatattccagaaacccca
cctcctggctacctgagtgaagatggagaaaccagtgaccaccagatgaaccacagcatg
gacgcaggttctccaaacctctccccgaatccgatgtccccagcacacaataacttggac
ctacagccagtcacctactgtgagccggccttctggtgctccatctcctactacgagctg
aaccagcgagttggggagacattccacgcctcacagccatccatgacagtagatggcttc
actgacccctccaactcggagcgcttctgcctgggcctactgtccaatgtcaaccggaat
gcagccgtggaacttacaaggcgacacattgggagaggtgtgcggctctactacatcgga
ggggaggtctttgcggagtgcctcagtgacagtgctattttcgtccagtctcccaactgc
aaccagcgctatggctggcacccggccactgtctgcaagatcccaccaggctgcaacctg
aagatcttcaacaaccaggaatttgctgccctcctagctcagtctgtcaaccagggcttt
gaggctgtctaccagctgacgcgcatgtgcaccatccgtatgagcttcgtcaaaggctgg
ggagcagagtacaggagacagacagtgaccagcaccccctgctggattgagctacacctg
aatggacccttgcagtggcttgacaaggtcctcacccagatgggttccccgagcatccgc
tgttccagtgtgtcttag

DBGET integrated database retrieval system