KEGG   Mus musculus (mouse): 17128Help
Entry
17128             CDS       T01002                                 

Gene name
Smad4, AW743858, D18Wsu70e, DPC4, Madh4
Definition
(RefSeq) SMAD family member 4
  KO
K04501  mothers against decapentaplegic homolog 4
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04068  FoxO signaling pathway
mmu04110  Cell cycle
mmu04310  Wnt signaling pathway
mmu04350  TGF-beta signaling pathway
mmu04371  Apelin signaling pathway
mmu04390  Hippo signaling pathway
mmu04520  Adherens junction
mmu04550  Signaling pathways regulating pluripotency of stem cells
mmu04659  Th17 cell differentiation
mmu04933  AGE-RAGE signaling pathway in diabetic complications
mmu05161  Hepatitis B
mmu05166  Human T-cell leukemia virus 1 infection
mmu05200  Pathways in cancer
mmu05210  Colorectal cancer
mmu05212  Pancreatic cancer
mmu05220  Chronic myeloid leukemia
mmu05225  Hepatocellular carcinoma
mmu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    17128 (Smad4)
   04350 TGF-beta signaling pathway
    17128 (Smad4)
   04390 Hippo signaling pathway
    17128 (Smad4)
   04371 Apelin signaling pathway
    17128 (Smad4)
   04068 FoxO signaling pathway
    17128 (Smad4)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    17128 (Smad4)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    17128 (Smad4)
   04550 Signaling pathways regulating pluripotency of stem cells
    17128 (Smad4)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    17128 (Smad4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    17128 (Smad4)
  09162 Cancer: specific types
   05210 Colorectal cancer
    17128 (Smad4)
   05212 Pancreatic cancer
    17128 (Smad4)
   05225 Hepatocellular carcinoma
    17128 (Smad4)
   05226 Gastric cancer
    17128 (Smad4)
   05220 Chronic myeloid leukemia
    17128 (Smad4)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    17128 (Smad4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    17128 (Smad4)
   05161 Hepatitis B
    17128 (Smad4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MH2 MH1 IRF-3
Motif
Other DBs
NCBI-GeneID: 17128
NCBI-ProteinID: NP_032566
MGI: 894293
Ensembl: ENSMUSG00000024515
Vega: OTTMUSG00000021090
UniProt: P97471
LinkDB All DBs
Structure
PDB: 

Position
18 E2; 18 49.51 cM
AA seq 551 aa AA seqDB search
MDNMSITNTPTSNDACLSIVHSLMCHRQGGESETFAKRAIESLVKKLKEKKDELDSLITA
ITTNGAHPSKCVTIQRTLDGRLQVAGRKGFPHVIYARLWRWPDLHKNELKHVKYCQYAFD
LKCDSVCVNPYHYERVVSPGIDLSGLTLQSNAPSMLVKDEYVHDFEGQPSLPTEGHSIQT
IQHPPSNRASTETYSAPALLAPAESNATSTTNFPNIPVASTSQPASILAGSHSEGLLQIA
SGPQPGQQQNGFTAQPATYHHNSTTTWTGSRTAPYTPNLPHHQNGHLQHHPPMPPHPGHY
WPVHNELAFQPPISNHPAPEYWCSIAYFEMDVQVGETFKVPSSCPVVTVDGYVDPSGGDR
FCLGQLSNVHRTEAIERARLHIGKGVQLECKGEGDVWVRCLSDHAVFVQSYYLDREAGRA
PGDAVHKIYPSAYIKVFDLRQCHRQMQQQAATAQAAAAAQAAAVAGNIPGPGSVGGIAPA
ISLSAAAGIGVDDLRRLCILRMSFVKGWGPDYPRQSIKETPCWIEIHLHRALQLLDEVLH
TMPIADPQPLD
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atggacaatatgtctataacaaatacaccaacaagtaacgatgcctgtctgagcattgta
catagtttgatgtgtcatagacaaggtggggaaagtgaaacctttgcaaaaagagcaatt
gagagtttggtaaagaagctgaaagagaaaaaagatgaattggattctttaataacagct
ataactacaaatggagctcatcctagcaagtgtgtcaccatacagagaacattggatgga
cgacttcaggtggctggtcggaaaggatttcctcatgtgatctatgcccgtctgtggagg
tggcctgatctacacaagaatgaactaaagcatgttaaatattgtcagtatgcgtttgac
ttaaaatgtgacagtgtctgtgtgaatccatatcactatgagcgggttgtctcacctgga
attgatctctcaggattaacactgcagagtaatgctccaagtatgttagtgaaggatgag
tacgttcacgactttgaaggacagccgtccttacccactgaaggacattcgattcaaacc
atccaacacccgccaagtaatcgcgcatcaacggagacgtacagcgccccggctctgtta
gccccggcagagtctaacgccaccagcaccaccaacttccccaacattcctgtggcttcc
acaagtcagccggccagtattctggcgggcagccatagtgaaggactgttgcagatagct
tcagggcctcagccaggacagcagcagaatggatttactgctcagccagctacttaccat
cataacagcactaccacctggactggaagtaggactgcaccatacacacctaatttgcct
caccaccaaaacggccatcttcagcaccacccgcctatgccgccccatcctggacattac
tggccagttcacaatgagcttgcattccagcctcccatttccaatcatcctgctcctgag
tactggtgctccattgcttactttgaaatggacgttcaggtaggagagacgtttaaggtc
ccttcaagctgccctgttgtgactgtggatggctatgtggatccttcgggaggagatcgc
ttttgcttgggtcaactctccaatgtccacaggacagaagcgattgagagagcgaggttg
cacataggcaaaggagtgcagttggaatgtaaaggtgaaggtgacgtttgggtcaggtgc
cttagtgaccacgcggtctttgtacagagttactacctggacagagaagctggccgagca
cctggcgacgctgttcataagatctacccaagcgcgtatataaaggtctttgatctgcgg
cagtgtcaccggcagatgcagcaacaggcggccactgcgcaagctgcagctgctgctcag
gcggcggccgtggcagggaacatccctggccctgggtccgtgggtggaatagctccagcc
atcagtctgtctgctgctgctggcatcggtgtggatgacctccggcgattgtgcattctc
aggatgagctttgtgaagggctggggcccagactaccccaggcagagcatcaaggaaacc
ccgtgctggattgagattcaccttcaccgagctctgcagctcttggatgaagtcctgcac
accatgcccattgcggacccacagcctttagactga

DBGET integrated database retrieval system