KEGG   Mus musculus (mouse): 17187Help
Entry
17187             CDS       T01002                                 

Gene name
Max, AA960152, AI875693, bHLHd4, bHLHd5, bHLHd6, bHLHd7, bHLHd8
Definition
(RefSeq) Max protein
  KO
K04453  Max protein
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu05200  Pathways in cancer
mmu05202  Transcriptional misregulation in cancer
mmu05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    17187 (Max)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    17187 (Max)
   05202 Transcriptional misregulation in cancer
    17187 (Max)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    17187 (Max)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    17187 (Max)
Transcription factors [BR:mmu03000]
 Eukaryotic Type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Cell cycle controlling factors, Mad/Max
    17187 (Max)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HLH Filament SlyX bZIP_2 Rab5-bind CREPT DUF5595 DUF5082 SLX9 ATG16 ZapB DUF4763 Csm1_N DivIC
Motif
Other DBs
NCBI-GeneID: 17187
NCBI-ProteinID: NP_032584
MGI: 96921
Ensembl: ENSMUSG00000059436
UniProt: P28574
LinkDB All DBs
Structure
PDB: 

Position
12 C3; 12 33.78 cM
AA seq 160 aa AA seqDB search
MSDNDDIEVESDEEQPRFQSAADKRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKASR
AQILDKATEYIQYMRRKNHTHQQDIDDLKRQNALLEQQVRALEKARSSAQLQTNYPSSDN
SLYTNAKGGTISAFDGGSDSSSESEPEEPQSRKKLRMEAS
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgagcgataacgatgacatcgaggtggagagcgacgaagagcaaccgaggtttcaatct
gcggctgacaagcgggctcaccataatgcactggaacgaaaacgtagggaccacatcaaa
gacagctttcacagtttgcgggactcagtcccatcactccaaggagagaaggcatcccgg
gcccaaatcctagacaaagcaacagagtatatccagtatatgcgaaggaaaaaccatacg
caccagcaagacattgatgacctcaagcggcagaatgctcttctggagcaacaagtccgt
gcactggagaaggcaagatcaagtgcccaactgcagaccaactacccctcctcagacaac
agcctctacaccaacgccaagggcggcaccatctctgccttcgatgggggttcagactcc
agctcagaatccgagcctgaagagccccagagcaggaagaaactccggatggaggccagc
taa

DBGET integrated database retrieval system