KEGG   Mus musculus (mouse): 17246Help
Entry
17246             CDS       T01002                                 

Gene name
Mdm2, 1700007J15Rik, AA415488, Mdm-2
Definition
(RefSeq) transformed mouse 3T3 cell double minute 2
  KO
K06643  E3 ubiquitin-protein ligase Mdm2 [EC:2.3.2.27]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01522  Endocrine resistance
mmu01524  Platinum drug resistance
mmu04068  FoxO signaling pathway
mmu04110  Cell cycle
mmu04115  p53 signaling pathway
mmu04120  Ubiquitin mediated proteolysis
mmu04144  Endocytosis
mmu04151  PI3K-Akt signaling pathway
mmu04218  Cellular senescence
mmu04625  C-type lectin receptor signaling pathway
mmu04919  Thyroid hormone signaling pathway
mmu05163  Human cytomegalovirus infection
mmu05165  Human papillomavirus infection
mmu05169  Epstein-Barr virus infection
mmu05200  Pathways in cancer
mmu05202  Transcriptional misregulation in cancer
mmu05203  Viral carcinogenesis
mmu05205  Proteoglycans in cancer
mmu05206  MicroRNAs in cancer
mmu05214  Glioma
mmu05215  Prostate cancer
mmu05218  Melanoma
mmu05219  Bladder cancer
mmu05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    17246 (Mdm2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    17246 (Mdm2)
   04151 PI3K-Akt signaling pathway
    17246 (Mdm2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    17246 (Mdm2)
  09143 Cell growth and death
   04110 Cell cycle
    17246 (Mdm2)
   04115 p53 signaling pathway
    17246 (Mdm2)
   04218 Cellular senescence
    17246 (Mdm2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    17246 (Mdm2)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    17246 (Mdm2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    17246 (Mdm2)
   05202 Transcriptional misregulation in cancer
    17246 (Mdm2)
   05206 MicroRNAs in cancer
    17246 (Mdm2)
   05205 Proteoglycans in cancer
    17246 (Mdm2)
   05203 Viral carcinogenesis
    17246 (Mdm2)
  09162 Cancer: specific types
   05214 Glioma
    17246 (Mdm2)
   05220 Chronic myeloid leukemia
    17246 (Mdm2)
   05218 Melanoma
    17246 (Mdm2)
   05219 Bladder cancer
    17246 (Mdm2)
   05215 Prostate cancer
    17246 (Mdm2)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    17246 (Mdm2)
   05169 Epstein-Barr virus infection
    17246 (Mdm2)
   05165 Human papillomavirus infection
    17246 (Mdm2)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    17246 (Mdm2)
   01522 Endocrine resistance
    17246 (Mdm2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    17246 (Mdm2)
   04121 Ubiquitin system [BR:mmu04121]
    17246 (Mdm2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     17246 (Mdm2)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    17246 (Mdm2)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   MDM2/MDM4 proteins
    17246 (Mdm2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C3HC4_3 SWIB zf-RanBP zf-RING_2 zf-FPG_IleRS zinc_ribbon_2
Motif
Other DBs
NCBI-GeneID: 17246
NCBI-ProteinID: NP_034916
MGI: 96952
Ensembl: ENSMUSG00000020184
Vega: OTTMUSG00000020921
UniProt: P23804
LinkDB All DBs
Position
10 D2; 10 66.32 cM
AA seq 489 aa AA seqDB search
MCNTNMSVSTEGAASTSQIPASEQETLVRPKPLLLKLLKSVGAQNDTYTMKEIIFYIGQY
IMTKRLYDEKQQHIVYCSNDLLGDVFGVPSFSVKEHRKIYAMIYRNLVAVSQQDSGTSLS
ESRRQPEGGSDLKDPLQAPPEEKPSSSDLISRLSTSSRRRSISETEENTDELPGERHRKR
RRSLSFDPSLGLCELREMCSGGSSSSSSSSSESTETPSHQDLDDGVSEHSGDCLDQDSVS
DQFSVEFEVESLDSEDYSLSDEGHELSDEDDEVYRVTVYQTGESDTDSFEGDPEISLADY
WKCTSCNEMNPPLPSHCKRCWTLRENWLPDDKGKDKVEISEKAKLENSAQAEEGLDVPDG
KKLTENDAKEPCAEEDSEEKAEQTPLSQESDDYSQPSTSSSIVYSSQESVKELKEETQDK
DESVESSFSLNAIEPCVICQGRPKNGCIVHGKTGHLMSCFTCAKKLKKRNKPCPVCRQPI
QMIVLTYFN
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgtgcaataccaacatgtctgtgtctaccgagggtgctgcaagcacctcacagattcca
gcttcggaacaagagactctggttagaccaaaaccattgcttttgaagttgttaaagtcc
gttggagcgcaaaacgacacttacactatgaaagagattatattttatattggccagtat
attatgactaagaggttatatgacgagaagcagcagcacattgtgtattgttcaaatgat
ctcctaggagatgtgtttggagtcccgagtttctctgtgaaggagcacaggaaaatatat
gcaatgatctacagaaatttagtggctgtaagtcagcaagactctggcacatcgctgagt
gagagcagacgtcagcctgaaggtgggagtgatctgaaggatcctttgcaagcgccacca
gaagagaaaccttcatcttctgatttaatttctagactgtctacctcatctagaaggaga
tccattagtgagacagaagagaacacagatgagctacctggggagcggcaccggaagcgc
cgcaggtccctgtcctttgatccgagcctgggtctgtgtgagctgagggagatgtgcagc
ggcggcagcagcagcagtagcagcagcagcagcgagtccacagagacgccctcgcatcag
gatcttgacgatggcgtaagtgagcattctggtgattgcctggatcaggattcagtttct
gatcagtttagcgtggaatttgaagttgagtctctggactcggaagattacagcctgagt
gacgaagggcacgagctctcagatgaggatgatgaggtctatcgggtcacagtctatcag
acaggagaaagcgatacagactcttttgaaggagatcctgagatttccttagctgactat
tggaagtgtacctcatgcaatgaaatgaatcctccccttccatcacactgcaaaagatgc
tggacccttcgtgagaactggcttccagacgataaggggaaagataaagtggaaatctct
gaaaaagccaaactggaaaactcagctcaggcagaagaaggcttggatgtgcctgatggc
aaaaagctgacagagaatgatgctaaagagccatgtgctgaggaggacagcgaggagaag
gccgaacagacgcccctgtcccaggagagtgacgactattcccaaccatcgacttccagc
agcattgtttatagcagccaagaaagcgtgaaagagttgaaggaggaaacgcaggacaaa
gacgagagtgtggaatctagcttctccctgaatgccatcgaaccatgtgtgatctgccag
gggcggcctaaaaatggctgcattgttcacggcaagactggacacctcatgtcatgtttc
acgtgtgcaaagaagctaaaaaaaagaaacaagccctgcccagtgtgcagacagccaatc
caaatgattgtgctaacttacttcaactag

DBGET integrated database retrieval system