KEGG   Mus musculus (mouse): 17268Help
Entry
17268             CDS       T01002                                 

Gene name
Meis1, C530044H18Rik, Evi8
Definition
(RefSeq) Meis homeobox 1
  KO
K15613  homeobox protein Meis1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04550  Signaling pathways regulating pluripotency of stem cells
mmu05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    17268 (Meis1)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    17268 (Meis1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    17268 (Meis1)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, MEIS
    17268 (Meis1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Meis_PKNOX_N Homeobox_KN Homeodomain
Motif
Other DBs
NCBI-GeneID: 17268
NCBI-ProteinID: NP_001180200
MGI: 104717
Ensembl: ENSMUSG00000020160
Vega: OTTMUSG00000005212
UniProt: Q60954
LinkDB All DBs
Position
11 A3.1; 11 11.11 cM
AA seq 390 aa AA seqDB search
MAQRYDDLPHYGGMDGVGIPSTMYGDPHAARSMQPVHHLNHGPPLHSHQYPHTAHTNAMA
PSMGSSVNDALKRDKDAIYGHPLFPLLALIFEKCELATCTPREPGVAGGDVCSSESFNED
IAVFAKQIRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGK
MPIDLVIDDREGGSKSDSEDVTRSANLTDQPSWNRDHDDTASTRSGGTPGPSSGGHTSHS
GDNSSEQGDGLDNSVASPSTGDDDDPDKDKKRHKKRGIFPKVATNIMRAWLFQHLTHPYP
SEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAVSQGTPYNPDGQPMGGFVM
DGQQHMGIRAPGPMSGMGMNMGMEGQWHYM
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaaaggtacgacgacctaccccattatgggggtatggatggagtaggcatcccc
tccacgatgtatggggacccgcatgcagccaggtccatgcaaccggtccaccacctgaac
cacgggcctcctctgcactcgcatcagtacccgcacacagctcacaccaacgccatggcc
cccagcatgggttcctcggtcaatgacgctttaaagagagataaagatgccatttatgga
caccccctcttccctctcttagcactgatttttgagaaatgtgaattagctacttgtacc
ccccgcgagccgggggtggcgggcggggacgtctgctcgtcagagtcattcaatgaagat
atagcggtgttcgccaaacagattcgcgcagaaaaacctctattctcttctaatccagaa
ctggataacttgatgattcaagccatacaagtgttaaggtttcatctgttggaattagag
aaggtacacgaattatgtgacaatttctgccaccggtatattagctgtttgaaagggaaa
atgcctatcgatttggtgatagatgatagagaaggaggatcaaaatcagacagtgaagat
gtaacaagatcagcaaatctaactgaccagccctcttggaatagagaccatgatgacacg
gcatccactcgttcaggaggaaccccgggcccttccagcggtggccatacttcacacagt
ggggataacagcagtgagcaaggtgatggcttggacaacagtgtagcttcccccagcaca
ggtgacgatgatgaccctgataaggacaaaaagcgtcacaaaaagcgtggcatctttccc
aaagtagccaccaatatcatgagggcgtggctgttccagcatctaacacacccttaccct
tctgaagaacagaaaaagcagttggcacaagatacaggacttaccatccttcaagtgaac
aattggtttattaatgcccggagaagaatagtgcagcccatgatagaccagtccaaccga
gcagtcagccaagggacaccttataaccctgatggacagccaatgggaggttttgtaatg
gacggtcagcagcacatgggcatcagagcgccaggacctatgagtggaatgggcatgaat
atgggcatggaggggcagtggcactacatgtaa

DBGET integrated database retrieval system