KEGG   Mus musculus (mouse): 17283
Entry
17283             CDS       T01002                                 

Gene name
Men1, AW045611, me
Definition
(RefSeq) multiple endocrine neoplasia 1
  KO
K14970  menin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04934  Cushing syndrome
mmu05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    17283 (Men1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    17283 (Men1)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Histone modification proteins
   HMT complexes
    MLL-HCF complex
     17283 (Men1)
SSDB
Motif
Pfam: Menin
Other DBs
NCBI-GeneID: 17283
NCBI-ProteinID: NP_001161961
MGI: 1316736
Ensembl: ENSMUSG00000024947
Vega: OTTMUSG00000018611
UniProt: O88559
LinkDB
Position
19; 19 A
AA seq 611 aa
MGLKAAQKTLFPLRSIDDVVRLFAAELGREEPDLVLLSLVLGFVEHFLAVNRVIPTNVPE
LTFQPSPAPDPPGGLTYFPVADLSIIAALYARFTAQIRGAVDLSLYPREGGVSSRELVKK
VSDVIWNSLSRSYFKDRAHIQSLFSFITGTKLDSSGVAFAVVGACQALGLRDVHLALSED
HAWVVFGPNGEQTAEVTWHGKGNEDRRGQTVNAGVAERSWLYLKGSYMRCDRKMEVAFMV
CAINPSIDLHTDSLELLQLQQKLLWLLYDLGHLERYPMALGNLADLEELEPTPGRPDPLT
LYHKGIASAKTYYQDEHIYPYMYLAGYHCRNRNVREALQAWADTATVIQDYNYCREDEEI
YKEFFEVANDVIPNLLKEAASLLETGEERTGEQAQGTQGQGSALQDPECFAHLLRFYDGI
CKWEEGSPTPVLHVGWATFLVQSLGRFEGQVRQKVHIVSREAEAAEAEEPWGDEAREGRR
RGPRRESKPEEPPPPKKPALDKGPGSGQSAGSGPPRKTSGTVPGTTRGGQEVGNAAQAPA
PAASPPPEGPVLTFQSEKMKGMKELLVATKINSSAIKLQLTAQSQVQMKKQKVSTPSDYT
LSFLKRQRKGL
NT seq 1836 nt   +upstreamnt  +downstreamnt
atggggctgaaggccgcccagaagacgctgttccctctgcgctctatcgacgacgtggtg
cgcctgtttgctgcagagctgggccgagaggagcctgacctggtgctcctgtccttggtc
ctgggcttcgtggagcatttcctggctgtcaaccgtgtcatccccaccaacgtgccggag
ctcaccttccagcccagccccgcacccgaccctcctggtggcctcacctacttcccggtg
gccgacctatccatcattgctgccctctatgcccgattcaccgctcagatccgcggcgct
gtggacctctccctctatcctcgagagggaggtgtttctagtcgcgaactggtaaaaaag
gtctcggatgtcatatggaacagcctcagccgctcctacttcaaggaccgggcccacatc
cagtccctcttcagcttcatcacaggcaccaaactggacagctcgggcgtggcctttgca
gtggtaggggcctgccaggctctgggtctcagagatgtccatctggccctgtctgaagat
catgcttgggtggtgtttgggcccaacggggagcagacagctgaggtgacgtggcacggc
aaaggcaacgaggaccgcagaggccagacagtcaatgccggtgtggctgagcggagctgg
ctgtacctgaaggggtcgtacatgcgctgcgaccgtaagatggaggtggcgttcatggtg
tgtgccatcaacccttccatcgatcttcacactgactctttggaactgttgcaactacag
cagaagctgctctggctgctgtatgacctcggacatctggaaagataccccatggcgcta
gggaacttggcagacctggaggagctggagcctaccccgggccggccagacccactcacc
ctttatcacaagggaattgcctcagctaagacctactaccaggatgaacacatctacccc
tacatgtacctggctggctaccactgtcgcaaccgaaatgtgcgcgaagccctgcaggcc
tgggccgacactgccactgttatccaagactacaactactgccgggaggatgaggagatc
tacaaggaattctttgaagtggccaatgacgtcatccccaacctgctgaaggaggcggcc
agcctgctagaaacaggcgaagagcggactggggagcaagcccagggcacccagggccaa
ggttctgctctccaggacccagaatgctttgcccacctgctgcgattttatgatggcatc
tgcaaatgggaggagggtagccccacaccagtactgcacgtaggctgggcaactttcctt
gtgcagtccctaggccgcttcgagggacaggtgcggcagaaggtgcacatagttagccgg
gaagcagaggcggccgaggctgaagaaccatggggggatgaagcccgagaaggccgtcgg
cgtggtccccgaagagagtccaagcctgaggagccaccaccacccaagaagcctgcattg
gacaagggcccgggctcaggacaaagtgcagggtcgggaccacctaggaaaacgtcaggg
actgtcccaggtactacccgcggtggccaggaagtcggcaatgctgctcaggctccagca
cctgcagcatcgccacccccagagggcccagtgctcactttccagagtgagaagatgaaa
ggcatgaaggagctactggtggccaccaagatcaactcgagcgccatcaagctgcaactc
acggcacagtcgcaagtgcagatgaagaaacagaaagtgtccacacccagcgactacaca
ctctctttcctaaagcggcagcgcaagggcctctga

DBGET integrated database retrieval system