KEGG   Mus musculus (mouse): 17311Help
Entry
17311             CDS       T01002                                 

Gene name
Kitl, Clo, Con, Gb, Kitlg, Mgf, SCF, SF, SLF, Sl, blz, contrasted
Definition
(RefSeq) kit ligand
  KO
K05461  KIT ligand
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04640  Hematopoietic cell lineage
mmu04916  Melanogenesis
mmu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    17311 (Kitl)
   04015 Rap1 signaling pathway
    17311 (Kitl)
   04010 MAPK signaling pathway
    17311 (Kitl)
   04072 Phospholipase D signaling pathway
    17311 (Kitl)
   04151 PI3K-Akt signaling pathway
    17311 (Kitl)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    17311 (Kitl)
  09152 Endocrine system
   04916 Melanogenesis
    17311 (Kitl)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    17311 (Kitl)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    17311 (Kitl)
Cytokines and growth factors [BR:mmu04052]
 Growth factors
  Growth factors (RTK binding)
   17311 (Kitl)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SCF DUF4448
Motif
Other DBs
NCBI-GeneID: 17311
NCBI-ProteinID: NP_038626
MGI: 96974
Ensembl: ENSMUSG00000019966
Vega: OTTMUSG00000020799
UniProt: P20826
LinkDB All DBs
Structure
PDB: 

Position
10 D1; 10 51.4 cM
AA seq 273 aa AA seqDB search
MKKTQTWIITCIYLQLLLFNPLVKTKEICGNPVTDNVKDITKLVANLPNDYMITLNYVAG
MDVLPSHCWLRDMVIQLSLSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVLCMEENAP
KNIKESPKRPETRSFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVT
KPFMLPPVAASSLRNDSSSSNRKAAKAPEDSGLQWTAMALPALISLVIGFAFGALYWKKK
QSSLTRAVENIQINEEDNEISMLQQKEREFQEV
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagacacaaacttggattatcacttgcatttatcttcaactgctcctatttaat
cctcttgtcaaaaccaaggagatctgcgggaatcctgtgactgataatgtaaaagacatt
acaaaactggtggcaaatcttccaaatgactatatgataaccctcaactatgtcgccggg
atggatgttttgcctagtcattgttggctacgagatatggtaatacaattatcactcagc
ttgactactcttctggacaagttctcaaatatttctgaaggcttgagtaattactccatc
atagacaaacttgggaaaatagtggatgacctcgtgttatgcatggaagaaaacgcaccg
aagaatataaaagaatctccgaagaggccagaaactagatcctttactcctgaagaattc
tttagtattttcaatagatccattgatgcctttaaggactttatggtggcatctgacact
agtgactgtgtgctctcttcaacattaggtcccgagaaagattccagagtcagtgtcaca
aaaccatttatgttaccccctgttgcagccagctcccttaggaatgacagcagtagcagt
aataggaaagccgcaaaggcccctgaagactcgggcctacaatggacagccatggcattg
ccggctctcatttcgcttgtaattggctttgcttttggagccttatactggaagaagaaa
cagtcaagtcttacaagggcagttgaaaatatacagattaatgaagaggataatgagata
agtatgttgcaacagaaagagagagaatttcaagaggtgtaa

DBGET integrated database retrieval system