KEGG   Mus musculus (mouse): 17342Help
Entry
17342             CDS       T01002                                 

Gene name
Mitf, BCC2, Bhlhe32, Gsfbcc2, Vitiligo, Wh, bw, mi, vit
Definition
(RefSeq) melanogenesis associated transcription factor
  KO
K09455  microphthalmia-associated transcription factor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04137  Mitophagy - animal
mmu04380  Osteoclast differentiation
mmu04916  Melanogenesis
mmu05200  Pathways in cancer
mmu05202  Transcriptional misregulation in cancer
mmu05218  Melanoma
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    17342 (Mitf)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    17342 (Mitf)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    17342 (Mitf)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    17342 (Mitf)
   05202 Transcriptional misregulation in cancer
    17342 (Mitf)
  09162 Cancer: specific types
   05218 Melanoma
    17342 (Mitf)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    17342 (Mitf)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Ubiquitous bHLH-ZIP factors
    17342 (Mitf)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MITF_TFEB_C_3_N DUF3371 HLH DUF726
Motif
Other DBs
NCBI-GeneID: 17342
NCBI-ProteinID: NP_001106669
MGI: 104554
Ensembl: ENSMUSG00000035158
Vega: OTTMUSG00000023284
UniProt: Q08874
LinkDB All DBs
Structure
PDB: 

Position
6 D3; 6 45.05 cM
AA seq 526 aa AA seqDB search
MQSESGIVADFEVGEEFHEEPKTYYELKSQPLKSSSSAEHSGASKPPLSSSTMTSRILLR
QQLMREQMQEQERREQQQKLQAAQFMQQRVAVSQTPAINVSVPTTLPSATQVPMEVLKVQ
THLENPTKYHIQQAQRHQVKQYLSTTLANKHASQVLSSPCPNQPGDHAMPPVPGSSAPNS
PMAMLTLNSNCEKEAFYKFEEQSRAESECPGMNTHSRASCMQMDDVIDDIISLESSYNEE
ILGLMDPALQMANTLPVSGNLIDLYSNQGLPPPGLTISNSCPANLPNIKRELTACIFPTE
SEARALAKERQKKDNHNLIERRRRFNINDRIKELGTLIPKSNDPDMRWNKGTILKASVDY
IRKLQREQQRAKDLENRQKKLEHANRHLLLRVQELEMQARAHGLSLIPSTGLCSPDLVNR
IIKQEPVLENCSQELVQHQADLTCTTTLDLTDGTITFTNNLGTMPESSPAYSIPRKMGSN
LEDILMDDALSPVGVTDPLLSSVSPGASKTSSRRSSMSAEETEHAC
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgcagtccgaatcgggaatcgtggcggatttcgaagtcggggaggagtttcacgaagaa
cccaaaacctattacgaactcaaaagtcaacctctgaagagcagcagttctgcagagcat
tctggggcctccaagcctccgttaagctcctccactatgacatcacgcatcttgctacgc
cagcaactcatgcgtgagcagatgcaggagcaggagcgcagggagcagcagcagaagctg
caggcagcccagttcatgcaacagagagtggccgtgagtcagacaccagccataaacgtc
agcgtgcccaccacccttccctctgccacccaggtgccgatggaagtccttaaggtgcag
acccacctggaaaaccccaccaagtaccacatacagcaagctcagaggcaccaggtaaag
cagtacctttctaccactttagcaaataaacatgccagccaagtcctgagctcaccatgt
ccaaaccagcctggcgaccatgccatgccaccagtgccggggagcagcgcacccaacagc
cctatggctatgctcactcttaactccaactgtgaaaaagaggcattttataagtttgag
gagcagagcagggcagagagtgagtgcccaggtatgaacacgcactctcgagcgtcgtgc
atgcagatggatgatgtaattgatgacatcatcagcctggaatcaagttataatgaagaa
attttgggcttgatggatccggccttgcaaatggcaaatacgttacccgtctctggaaac
ttgatcgacctctacagcaaccagggcctgccaccgccaggccttaccatcagcaactcc
tgtccagccaaccttcccaacataaaaagggagctcacagcgtgtattttccccacagag
tctgaagcaagagcattggctaaagagaggcagaaaaaggacaatcacaacttgattgaa
cgaagaagaagatttaacataaacgaccgcattaaggagctaggtactctgatccccaag
tcaaatgatccagacatgcggtggaacaagggaaccattctcaaggcctctgtggactac
atccggaagttgcaacgggaacagcaacgagctaaggaccttgaaaaccgacagaagaag
ctggagcatgcgaaccggcacctgctgctcagagtacaggagctggagatgcaggctaga
gcgcatggactttcccttatcccatccaccggtctctgctcgcctgatctggtgaatcgg
atcatcaagcaagaaccagttcttgagaactgcagccaggaacttgtacagcaccaggca
gacctgacatgtacgacaactctggatctcacggacggtaccatcacctttaccaacaac
ctcggcaccatgccggagagcagcccggcctacagcatccccaggaagatgggctccaac
ttggaagacatcctgatggacgatgccctctcacctgttggagtcaccgacccactgctg
tcatcagtgtcgccaggagcttcaaaaacaagcagccggaggagcagtatgagcgcagaa
gaaacggagcatgcgtgttag

DBGET integrated database retrieval system