KEGG   Mus musculus (mouse): 17350Help
Entry
17350             CDS       T01002                                 

Gene name
Mlh1, 1110035C23Rik, AI317206, AI325952, AI561766
Definition
(RefSeq) mutL homolog 1
  KO
K08734  DNA mismatch repair protein MLH1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01524  Platinum drug resistance
mmu03430  Mismatch repair
mmu03460  Fanconi anemia pathway
mmu05200  Pathways in cancer
mmu05210  Colorectal cancer
mmu05213  Endometrial cancer
mmu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    17350 (Mlh1)
   03460 Fanconi anemia pathway
    17350 (Mlh1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    17350 (Mlh1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    17350 (Mlh1)
   05226 Gastric cancer
    17350 (Mlh1)
   05213 Endometrial cancer
    17350 (Mlh1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    17350 (Mlh1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mmu03400]
    17350 (Mlh1)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    MutL homologs
     17350 (Mlh1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mlh1_C DNA_mis_repair HATPase_c_3 HATPase_c Hfx_Cass5
Motif
Other DBs
NCBI-GeneID: 17350
NCBI-ProteinID: NP_081086
MGI: 101938
Ensembl: ENSMUSG00000032498
Vega: OTTMUSG00000031784
UniProt: Q9JK91
LinkDB All DBs
Position
9 F3; 9 60.92 cM
AA seq 760 aa AA seqDB search
MAFVAGVIRRLDETVVNRIAAGEVIQRPANAIKEMIENCLDAKSTNIQVVVKEGGLKLIQ
IQDNGTGIRKEDLDIVCERFTTSKLQTFEDLASISTYGFRGEALASISHVAHVTITTKTA
DGKCAYRASYSDGKLQAPPKPCAGNQGTLITVEDLFYNIITRRKALKNPSEEYGKILEVV
GRYSIHNSGISFSVKKQGETVSDVRTLPNATTVDNIRSIFGNAVSRELIEVGCEDKTLAF
KMNGYISNANYSVKKCIFLLFINHRLVESAALRKAIETVYAAYLPKNTHPFLYLSLEISP
QNVDVNVHPTKHEVHFLHEESILQRVQQHIESKLLGSNSSRMYFTQTLLPGLAGPSGEAA
RPTTGVASSSTSGSGDKVYAYQMVRTDSREQKLDAFLQPVSSLGPSQPQDPAPVRGARTE
GSPERATREDEEMLALPAPAEAAAESENLERESLMETSDAAQKAAPTSSPGSSRKRHRED
SDVEMVENASGKEMTAACYPRRRIINLTSVLSLQEEISERCHETLREMLRNHSFVGCVNP
QWALAQHQTKLYLLNTTKLSEELFYQILIYDFANFGVLRLSEPAPLFDLAMLALDSPESG
WTEDDGPKEGLAEYIVEFLKKKAEMLADYFSVEIDEEGNLIGLPLLIDSYVPPLEGLPIF
ILRLATEVNWDEEKECFESLSKECAMFYSIRKQYILEESTLSGQQSDMPGSTSKPWKWTV
EHIIYKAFRSHLLPPKHFTEDGNVLQLANLPDLYKVFERC
NT seq 2283 nt NT seq  +upstreamnt  +downstreamnt
atggcgtttgtagcaggagttattcggcgtctggacgagacggtagtgaaccgcatagcg
gcgggggaagtcattcagcggccggccaatgctatcaaagagatgatagaaaactgttta
gatgcaaaatctacaaatattcaagtggttgttaaggaaggtggcctgaagctaattcag
atccaagacaatggcactggaatcaggaaggaagatctggatattgtgtgtgagaggttc
actacgagtaaactgcagacttttgaggatttagccagtatttctacctatggctttcgt
ggtgaggcattggcaagcataagccatgtggcccatgtcactattacaaccaaaacagct
gatgggaaatgtgcgtacagagcaagttactcagatggaaagctgcaagcccctcctaaa
ccctgtgcaggcaaccagggcaccctgatcacggtggaagaccttttttacaacataatc
acaaggaggaaagctttaaaaaatccaagtgaagagtacggaaaaattttggaagttgtt
ggcaggtattcaatacacaattcaggcattagtttctcagttaaaaaacaaggtgagaca
gtatctgatgtcagaacactgcccaatgccacaaccgtggacaacattcgctccatcttt
ggaaatgcggttagtcgagaactgatagaagttgggtgtgaggataaaaccctagctttc
aaaatgaatggctatatatcgaatgcaaactattcagtgaagaagtgcattttcctactc
ttcatcaaccaccgtctggtagaatcagctgccttgagaaaagccattgaaactgtatat
gcagcatacttgcccaaaaacacacacccattcctgtacctcagtttggaaatcagccct
cagaacgtggacgtcaatgtacaccccaccaagcacgaagttcactttctgcacgaggag
agcattctgcagcgtgtgcagcagcacattgagagcaagctgctgggctccaattcctcc
aggatgtatttcacccagaccttgcttccaggacttgctgggccttctggggaggcagct
agacccacgacaggggtggcttcctcatccactagtggaagtggcgacaaggtctacgct
taccagatggtccgtacggactcccgggagcagaagcttgacgcctttctgcagcctgta
agcagccttgggcccagccagccccaggaccctgcccctgtccgaggggccaggacggag
ggatctcctgaaagggccacgcgggaggacgaggagatgcttgctctcccagcccccgct
gaagcagctgctgagagtgagaacttggagagggaatcactaatggagacttcagacgca
gcccagaaggcggcacccacttccagtccaggaagctccagaaagagacatcgggaggac
tctgatgtggaaatggtggaaaatgcttccgggaaggaaatgacagctgcttgctacccc
aggaggaggatcattaacctcaccagcgtcttgagtctccaggaagagattagtgagcgg
tgccatgagactctccgggagatgctccgtaaccattcctttgtgggctgtgtgaatcct
cagtgggccttggcacagcaccagaccaagctctacctcctcaacactaccaagctcagt
gaagagctgttctaccagatactcatttatgattttgccaactttggtgttctgaggtta
tcggaaccagcgccactcttcgacctggccatgctggccttagacagtcctgaaagtggc
tggacagaggacgacggcccgaaggaagggcttgcagagtacattgttgagtttctgaag
aagaaagcggagatgcttgcagactatttctctgtggagatcgatgaggaagggaacctg
attggattacctcttctgattgacagctatgtgccacctttggagggactgcctatcttc
attcttcgactggccactgaggtgaattgggatgaagaaaaggagtgttttgaaagtctc
agtaaagaatgtgctatgttttactccattcggaagcagtatatactggaggagtcgacc
ctctcaggccagcagagtgacatgcctggctccacgtcaaagccctggaagtggactgtg
gagcacattatctataaagccttccgctcacacctcctacctccgaagcatttcacagaa
gatggcaatgtcctgcagcttgccaacctgccagatctatacaaagtctttgagcggtgt
taa

DBGET integrated database retrieval system