KEGG   Mus musculus (mouse): 17356Help
Entry
17356             CDS       T01002                                 

Gene name
Afdn, 5033403D15Rik, AF6, Af-6, Afadin, Gm314, I-afadin, Mllt4, S-afadin
Definition
(RefSeq) afadin, adherens junction formation factor
  KO
K05702  afadin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04024  cAMP signaling pathway
mmu04520  Adherens junction
mmu04530  Tight junction
mmu04670  Leukocyte transendothelial migration
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    17356 (Afdn)
   04015 Rap1 signaling pathway
    17356 (Afdn)
   04024 cAMP signaling pathway
    17356 (Afdn)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    17356 (Afdn)
   04530 Tight junction
    17356 (Afdn)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    17356 (Afdn)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RA DIL PDZ PDZ_6 FHA PDZ_2 Yop-YscD_cpl
Motif
Other DBs
NCBI-GeneID: 17356
NCBI-ProteinID: NP_034936
MGI: 1314653
Ensembl: ENSMUSG00000068036
Vega: OTTMUSG00000029503
UniProt: Q9QZQ1
LinkDB All DBs
Structure
PDB: 

Position
17; 17 A1
AA seq 1820 aa AA seqDB search
MSAGGRDEERRKLADIIHHWNANRLDLFEISQPTEDLEFHGVMRFYFQDKAAGNFATKCI
RVSSTATTQDVIETLAEKFRPDMRMLSSPKYSLYEVHVSGERRLDIDEKPLVVQLNWNKD
DREGRFVLKNENDAIPAKKAQSNGPEKQEKEGVIQNFKRTLSKKEKKEKKKKEKEALRQA
SDKEERPSQGDDSENSRLAAEVYKDMPETSFTRTISNPEVVMKRRRQQKLEKRMQEFRSS
DGRPDSGGTLRIYADSLKPNIPYKTILLSTTDTADFAVAESLEKYGLEKENPKDYCIARV
MLPPGAQHSDERGAKEIILDDDECPLQIFREWPSDKGILVFQLKRRPPDYIPKKMKKHVE
GKSLKGKDRADGSGYGSALPPEKLPYLVELSPGRRNHFAYYSYHTYEDGSDSRDKPKLYR
LQLSVTEVGTEKFDDNSIQLFGPGIQPHHCDLTNMDGVVTVTPRSMDAETYVDGQRISET
TMLQSGMRLQFGTSHVFKFVDPIQDHVLSKRSVDGGLMVKGPRHKPGAVQETTFELGGDV
HSGTALPASRSTTRLDSDRVSSASSTAERGMVKPMIRLDQEQEYRRRENRTQDATGPELI
LPASIEFRESSEDSFLSAIINYTNSSTVHFKLSPTYVLYMACRYVLSSQHRPDISPTERT
HKAIAVVNKMVSMMEGVIQKQKNIAGALAFWMANASELLNFIKQDRDLSRITLDAQDVLA
HLVQMAFKYLVHCLQSELNNYMPAFLDDPEENSLQRPKIDDVLHTLTGAMSLLRRCRVNA
ALTIQLFSQLFHFINMWLFNRLVTDPDSGLCSHYWGAIIRQQLGHIEAWAEKQGLELAAD
CHLSRIVQATTLLTMDKYVPDDIPNINSTCFKLNSLQLQALLQNYHCAPDEPFIPTDLIE
NVVAVAENTADELARSDGRDVQLEEDPDLQLPFLLPEDGYSCDVVRNIPNGLQEFLDPLC
QRGFCRLVPHTRSPGTWTIYFEGADYESHLMRENAELAQPLRKEPEIITVTLKKQNGMGL
SIVAAKGAGQDKLGIYVKSVVKGGAADVDGRLAAGDQLLSVDGRSLVGLSQERAAELMTR
TSSVVTLEVAKQGAIYHGLATLLNQPSPMMQRISDRRGSGKPRPKSEGFELYNNSAQNGS
PESPQMPWTEYSEPKKLPGDDRLMKNRADHRSSPNVANQPPSPGGKGPYTSGTAAKITSV
STGNLCTEEQSPPPRPEAYPIPTQTYTREYFTFPASKSQDRMAPPQSQWPNYEEKPHVHT
ESNHSSIAIQRVTRSQEELREEKVYQLERHRVEAGMDRKCDSDMWINQSSSVESSTSSQE
HLNHSSKSVTPASTLTKSGPGRWKTPAAVLPTPVAVSQPIRTDLPPPPPPPPVHYTSEFD
GIPMDLPLPPPPANQAGPQSAQVAAAEWKKREEHQRWYEKEKARLEEERERKRREQERKL
GQMRSQTLNPASFSPLATQAKPEKPSTLQRPQETVIRELQPQQQPRTIERKDLQYITISK
EELSSGDSLSPDPWKRDAREKLEKQQQMHIVDMLSKEIHELQNKVDRTAEESDRLRKLML
EWQFQKRLQESKQKDEDDDEEEDDDVDTMLIMQRLEAERRARMQDEERRRQQQLEEMRKR
EAEDRVRQEEDGRHQEEERVKRDAEEKRRQEEGYYSRLEAERRRQHEEAARRLLEPEEPG
LSRPPLPRDYEPPSLSSAPCAPPPPPQRNASYLKTQVLSPDSLFTAKFVAYDEEEEDYGP
AGPNSYSGSAGTAVGAYDAPREAREKLTRSQDADLPGSSGAPENLTFKERQRLFSQGQDV
SDKVKASRKLTELENELNTK
NT seq 5463 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcgggcggccgcgacgaagagcggcggaagctggccgacatcattcaccactgg
aacgccaaccggctggacctgttcgagatcagccagccgaccgaggatttggagtttcat
ggagtcatgagattttattttcaagataaagctgctggaaactttgcaacaaaatgtatt
cgagtctctagcacagccaccactcaagatgtgattgaaacactggcagagaagttccgc
cctgacatgcgcatgctctcctctcccaagtactccctctatgaagtgcatgtcagtgga
gaaagaagattggacattgatgagaaacctctagttgtacagttgaattggaacaaagat
gatcgagagggtcgattcgtccttaagaacgagaatgacgccattcctgccaagaaggct
cagagtaatggacctgaaaagcaggagaaagaaggtgttattcagaacttcaaaagaact
ctctcaaagaaagaaaagaaggaaaaaaagaagaaagagaaggaggcattgagacaagcc
tctgataaggaagaaaggccttctcaaggggatgacagtgagaactcacgactggctgct
gaagtttacaaagacatgcctgagaccagctttactaggaccatttctaaccctgaagtt
gtcatgaaacggcggcggcagcaaaaactggagaagagaatgcaagagtttcggagctca
gatgggcggcctgactcaggtggaacactgaggatatatgcagatagtttaaaaccaaat
attccatacaagacaatcctgctgtctactaccgataccgcagactttgctgtagccgaa
tctttggagaagtatggtctggaaaaagagaatcccaaggactactgtattgcccgggtt
atgcttcctcctggagcccagcattctgatgagagaggtgctaaggaaataattcttgac
gatgatgaatgtcctttacaaatcttcagggaatggccaagtgacaaagggattttagtc
tttcagttgaagaggagaccaccggactacatcccaaagaaaatgaagaaacatgttgaa
gggaagtcgttgaaggggaaagacagagctgacgggtctggctacggctccgctcttcct
cccgagaagctgccctacttagtagagctaagcccagggagaaggaatcactttgcctac
tacagctatcacacttacgaagatggctctgactccagagacaagccaaagttataccgc
cttcaattaagtgtgactgaagttgggacagagaaatttgatgacaattctatccagctg
tttggccccggaattcagccccatcactgtgatctcaccaacatggatggagtggtcact
gtgacacccagaagtatggatgcagagacctacgtggatggtcagcgcatctcagagacc
acaatgctgcagagtggcatgagactgcagtttggcacctcgcatgtgtttaagtttgtg
gaccccatccaggaccacgttctttccaagagatctgtggatggaggcctgatggtcaag
ggcccaagacataaacctggagctgttcaggagacaacctttgaattgggaggagatgtc
cacagtgggacagcattgccggcaagcaggagcactactagactggacagtgacagggtg
tcctctgcctctagcacagctgagcgagggatggtgaagccgatgatccgactggaccag
gagcaggaatatcgacgacgagaaaacaggactcaggatgctactgggcctgaactgata
ctgcctgccagcattgaattcagggaaagctctgaagactcttttttatctgccattata
aactataccaatagttctacagttcattttaagttgtcacctacatatgtgttatacatg
gcatgccggtatgtattgtccagccagcacaggcccgacatcagtcctacagagcgtaca
cataaggccattgctgttgtcaacaagatggtgagcatgatggaaggggtcatccagaaa
cagaagaacattgcaggagcacttgctttttggatggcaaatgcatctgagcttctcaac
ttcatcaagcaggaccgagaccttagtcggatcacgctggatgcccaggatgtcctagca
cacttggttcagatggcatttaagtacttggttcattgccttcagtcagaacttaataac
tacatgccagcctttctggatgatcctgaggagaacagtctgcaaagaccaaaaatagat
gatgtgctgcacacactcacaggagccatgtccttgctgcggcgctgcagagtcaatgct
gccttgaccatccagctcttctctcagcttttccacttcatcaatatgtggctgttcaac
agactggtgactgacccagattcaggcctgtgctcccactactggggtgccattatccgc
cagcagctggggcatattgaagcgtgggcagagaagcaggggctagagctggcagctgac
tgtcacttgagcagaattgtacaggctacaacattgcttacgatggataagtatgtacct
gatgacattccaaatataaacagcacatgctttaagttaaattctctgcagcttcaagcc
ttgttacaaaattaccactgtgcacccgatgagccttttattcctacggatctcatagaa
aatgttgtggctgttgctgagaacacagctgatgagctcgcccgcagtgatggcagagac
gtgcagctggaggaagacccagacctacagctgccttttcttctgccagaagatggctat
tcctgtgatgttgtcagaaacattccaaatggtttacaagaatttttagaccctctgtgc
cagagaggattttgtagattggttcctcacacacgttcaccaggtacctggacaatatat
tttgaaggagcagattatgaaagtcaccttatgcgtgagaacgcagaactggcccagcct
ctgaggaaggagcctgagataatcactgtgactctgaagaagcagaatggaatgggcctc
agcatcgttgcagccaagggtgctggccaggataaactgggaatctacgttaagtcggtt
gtcaaaggaggtgctgcagatgtggatggacgattagctgctggtgaccaactcctcagt
gtggatggacgaagtctggttggactttctcaggaaagggcagcagaactcatgacaaga
accagttccgtggttacactggaagttgcaaagcaaggtgccatctatcacggcctggcc
accctccttaaccagccgtcccccatgatgcaaagaatttcagatcgtcgtggctcaggt
aaacccagaccaaagagtgaaggttttgagctctataataattcagctcaaaatggctcc
ccagagagtcctcagatgccttggacagagtacagtgagccaaagaaactgcctggggat
gacaggctgatgaaaaacagagcggaccaccgttccagccccaatgtggcaaatcagcct
cctagccctggagggaagggtccatatacatctggaacagcagctaagataacatctgtc
tccactggaaacctctgcactgaggagcagtcccctccacccagacctgaagcctatcct
atccctactcagacatacaccagagagtattttacctttccagcttcaaagtcgcaggat
cggatggctcctcctcagagccagtggccaaattatgaggaaaaaccacatgtgcacaca
gaaagtaatcattccagtattgcaatccagcgtgttacccgttcccaggaagagcttcgg
gaagaaaaggtttaccaacttgagcggcatcgagtagaggcaggcatggatcgcaagtgt
gacagtgatatgtggatcaatcagagctcctcagtggaatccagcacatccagccaggaa
cacctgaaccattcttccaagtcagttacccctgcttccactctgaccaagagtggtcct
ggccgttggaaaacaccagcagcggtgctgcccacccctgtggctgtctctcagcccatt
cgaacagacctccctccaccaccacctccaccgccggtccactacaccagtgagtttgat
ggtattccaatggatttgcccctcccacctcctcctgccaaccaggcaggaccccagtct
gctcaggtggctgctgcagagtggaaaaagagagaggagcaccagaggtggtatgagaaa
gagaaggcccgcctggaggaagaacgagagagaaagcgcagggagcaggagcggaagttg
gggcagatgcgctctcagaccctgaaccctgcttccttctcacctttggccacacaggcc
aagccagaaaagccttccacactgcagaggccccaagaaacagtcattcgggagcttcag
ccccagcagcagccccgcacgatcgagcgcaaggatctgcagtatataaccatcagtaaa
gaggagctgtcctctggtgatagtctgtctccagacccctggaaacgagatgccagggag
aagctggagaagcaacagcaaatgcacattgtggacatgctaagcaaggagatccacgag
ctgcaaaacaaggtggaccgtactgcggaggagagtgaccgcctgcggaagcttatgctg
gagtggcagttccagaagagactacaggagtccaaacagaaggatgaggatgatgacgaa
gaggaagatgatgatgtggacaccatgctgatcatgcagcgtctggaggccgagcggaga
gccaggatgcaggatgaggagcgcaggcgccagcaacagttggaagagatgcggaaacga
gaagcagaagatcgagtaagacaagaggaagatggacgccatcaggaggaggagcgagta
aagagagatgctgaagaaaagaggcgacaggaggaagggtattacagccgcctagaagct
gagaggcgccgacagcacgaagaggcagcacgcaggctgctggagcctgaagagcccggg
ctgagccgacctccacttccacgggactatgagcccccgtccttgtcctcagcaccctgt
gcccctcctcccccacctcagcgaaacgcatcctacctcaaaacacaggtcctctcccca
gactcgctgttcactgccaagtttgttgcgtatgatgaggaggaggaggactacggccca
gcaggaccaaactcttactcgggatctgcaggcacagctgtgggagcctatgatgcccct
cgggaagcgagagagaaactgactaggagccaagacgcagacttacctggcagttctgga
gcccctgaaaatctgacatttaaagagcgtcagcgccttttttcacaagggcaggatgtg
tctgacaaagtgaaagcttctcgtaaattaacagagctcgagaatgaactgaacacaaag
tga

DBGET integrated database retrieval system