KEGG   Mus musculus (mouse): 17390Help
Entry
17390             CDS       T01002                                 

Gene name
Mmp2, Clg4a, GelA, MMP-2
Definition
(RefSeq) matrix metallopeptidase 2
  KO
K01398  matrix metalloproteinase-2 (gelatinase A) [EC:3.4.24.24]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01522  Endocrine resistance
mmu04670  Leukocyte transendothelial migration
mmu04912  GnRH signaling pathway
mmu04915  Estrogen signaling pathway
mmu04926  Relaxin signaling pathway
mmu04933  AGE-RAGE signaling pathway in diabetic complications
mmu05200  Pathways in cancer
mmu05205  Proteoglycans in cancer
mmu05219  Bladder cancer
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    17390 (Mmp2)
  09152 Endocrine system
   04912 GnRH signaling pathway
    17390 (Mmp2)
   04915 Estrogen signaling pathway
    17390 (Mmp2)
   04926 Relaxin signaling pathway
    17390 (Mmp2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    17390 (Mmp2)
   05205 Proteoglycans in cancer
    17390 (Mmp2)
  09162 Cancer: specific types
   05219 Bladder cancer
    17390 (Mmp2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    17390 (Mmp2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    17390 (Mmp2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    17390 (Mmp2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    17390 (Mmp2)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.24  gelatinase A
     17390 (Mmp2)
Peptidases and inhibitors [BR:mmu01002]
 Metallo Peptidases
  Family M10
   17390 (Mmp2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M10 fn2 Hemopexin PG_binding_1 Reprolysin_3 Reprolysin_5 Peptidase_M66 Reprolysin_4
Motif
Other DBs
NCBI-GeneID: 17390
NCBI-ProteinID: NP_032636
MGI: 97009
Ensembl: ENSMUSG00000031740
Vega: OTTMUSG00000061536
UniProt: P33434 Q3UG07
LinkDB All DBs
Position
8 C5; 8 44.99 cM
AA seq 662 aa AA seqDB search
MEARVAWGALAGPLRVLCVLCCLLGRAIAAPSPIIKFPGDVAPKTDKELAVQYLNTFYGC
PKESCNLFVLKDTLKKMQKFFGLPQTGDLDQNTIETMRKPRCGNPDVANYNFFPRKPKWD
KNQITYRIIGYTPDLDPETVDDAFARALKVWSDVTPLRFSRIHDGEADIMINFGRWEHGD
GYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLGEGQVVRVKYGNADGEYCKFPFLFN
GREYSSCTDTGRSDGFLWCSTTYNFEKDGKYGFCPHEALFTMGGNADGQPCKFPFRFQGT
SYNSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVGGNSEGAPCVFPFTFLGNKY
ESCTSAGRNDGKVWCATTTNYDDDRKWGFCPDQGYSLFLVAAHEFGHAMGLEHSQDPGAL
MAPIYTYTKNFRLSHDDIKGIQELYGPSPDADTDTGTGPTPTLGPVTPEICKQDIVFDGI
AQIRGEIFFFKDRFIWRTVTPRDKPTGPLLVATFWPELPEKIDAVYEAPQEEKAVFFAGN
EYWVYSASTLERGYPKPLTSLGLPPDVQQVDAAFNWSKNKKTYIFAGDKFWRYNEVKKKM
DPGFPKLIADSWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWL
GC
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atggaggcacgagtggcctggggagcgctggccggacctctgcgggttctctgcgtcctg
tgctgcctgttgggccgcgccatcgctgcaccatcgcccatcatcaagttccccggcgat
gtcgcccctaaaacagacaaagagttggcagtgcaatacctgaacactttctatggctgc
cccaaggagagttgcaacctctttgtgctgaaagataccctcaagaagatgcagaagttc
tttgggctgccccagacaggtgaccttgaccagaacaccatcgagaccatgcggaagcca
agatgtggcaacccagatgtggccaactacaacttcttcccccgcaagcccaagtgggac
aagaaccagatcacatacaggatcattggttacacacctgacctggaccctgaaaccgtg
gatgatgcttttgctcgggccttaaaagtatggagcgacgtcactccgctgcgcttttct
cgaatccatgatggggaggctgacatcatgatcaactttggacgctgggagcatggagat
ggatacccatttgatggcaaggatggactcctggcacatgcctttgccccgggcactggt
gttgggggagattctcactttgatgatgatgagctgtggaccctgggagaaggacaagtg
gtccgcgtaaagtatgggaacgctgatggcgagtactgcaagttccccttcctgttcaac
ggtcgggaatacagcagctgtacagacactggtcgcagtgatggcttcctctggtgctcc
accacatacaactttgagaaggatggcaagtatggcttctgcccccatgaagccttgttt
accatgggtggcaatgcagatggacagccctgcaagttcccgttccgcttccagggcacc
tcctacaacagctgtaccaccgagggccgcaccgatggctaccgctggtgtggcaccacc
gaggactatgaccgggataagaagtatggattctgtcccgagaccgctatgtccactgtg
ggtggaaattcagaaggtgccccatgtgtcttccccttcactttcctgggcaacaagtat
gagagctgcaccagcgccggccgcaacgatggcaaggtgtggtgtgcgaccacaaccaac
tacgatgatgaccggaagtggggcttctgtcctgaccaaggatatagcctattcctcgtg
gcagcccatgagttcggccatgccatggggctggaacactctcaggaccctggagctctg
atggccccgatctacacctacaccaagaacttccgattatcccatgatgacatcaagggg
atccaggagctctatgggccctcccccgatgctgatactgacactggtactggccccaca
ccaacactgggacctgtcactccggagatctgcaaacaggacattgtctttgatggcatc
gctcagatccgtggtgagatcttcttcttcaaggaccggtttatttggcggacagtgaca
ccacgtgacaagcccacaggtcccttgctggtggccacattctggcctgagctcccagaa
aagattgacgctgtgtatgaggccccacaggaggagaaggctgtgttcttcgcagggaat
gagtactgggtctattctgctagtactctggagcgaggataccccaagccactgaccagc
ctggggttgccccctgatgtccagcaagtagatgctgcctttaactggagtaagaacaag
aagacatacatctttgcaggagacaagttctggagatacaatgaagtgaagaagaaaatg
gaccccggtttccctaagctcatcgcagactcctggaatgccatccctgataacctggat
gccgtcgtggacctgcagggtggtggtcatagctacttcttcaagggtgcttattacctg
aagctggagaaccaaagtctcaagagcgtgaagtttggaagcatcaaatcagactggctg
ggctgctga

KEGG   Mus musculus (mouse): 17395Help
Entry
17395             CDS       T01002                                 

Gene name
Mmp9, AW743869, B/MMP9, Clg4b, Gel_B, MMP-9, pro-MMP-9
Definition
(RefSeq) matrix metallopeptidase 9
  KO
K01403  matrix metalloproteinase-9 (gelatinase B) [EC:3.4.24.35]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01522  Endocrine resistance
mmu04657  IL-17 signaling pathway
mmu04668  TNF signaling pathway
mmu04670  Leukocyte transendothelial migration
mmu04915  Estrogen signaling pathway
mmu04926  Relaxin signaling pathway
mmu05161  Hepatitis B
mmu05200  Pathways in cancer
mmu05202  Transcriptional misregulation in cancer
mmu05205  Proteoglycans in cancer
mmu05206  MicroRNAs in cancer
mmu05215  Prostate cancer
mmu05219  Bladder cancer
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    17395 (Mmp9)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    17395 (Mmp9)
   04670 Leukocyte transendothelial migration
    17395 (Mmp9)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    17395 (Mmp9)
   04926 Relaxin signaling pathway
    17395 (Mmp9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    17395 (Mmp9)
   05202 Transcriptional misregulation in cancer
    17395 (Mmp9)
   05206 MicroRNAs in cancer
    17395 (Mmp9)
   05205 Proteoglycans in cancer
    17395 (Mmp9)
  09162 Cancer: specific types
   05219 Bladder cancer
    17395 (Mmp9)
   05215 Prostate cancer
    17395 (Mmp9)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    17395 (Mmp9)
  09172 Infectious disease: viral
   05161 Hepatitis B
    17395 (Mmp9)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    17395 (Mmp9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    17395 (Mmp9)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.35  gelatinase B
     17395 (Mmp9)
Peptidases and inhibitors [BR:mmu01002]
 Metallo Peptidases
  Family M10
   17395 (Mmp9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M10 fn2 Hemopexin PT PG_binding_1 Reprolysin_4 Peptidase_M66 Reprolysin_3 DUF4953
Motif
Other DBs
NCBI-GeneID: 17395
NCBI-ProteinID: NP_038627
MGI: 97011
Ensembl: ENSMUSG00000017737
Vega: OTTMUSG00000001184
UniProt: P41245
LinkDB All DBs
Position
2 H3; 2 85.27 cM
AA seq 730 aa AA seqDB search
MSPWQPLLLALLAFGCSSAAPYQRQPTFVVFPKDLKTSNLTDTQLAEAYLYRYGYTRAAQ
MMGEKQSLRPALLMLQKQLSLPQTGELDSQTLKAIRTPRCGVPDVGRFQTFKGLKWDHHN
ITYWIQNYSEDLPRDMIDDAFARAFAVWGEVAPLTFTRVYGPEADIVIQFGVAEHGDGYP
FDGKDGLLAHAFPPGAGVQGDAHFDDDELWSLGKGVVIPTYYGNSNGAPCHFPFTFEGRS
YSACTTDGRNDGTPWCSTTADYDKDGKFGFCPSERLYTEHGNGEGKPCVFPFIFEGRSYS
ACTTKGRSDGYRWCATTANYDQDKLYGFCPTRVDATVVGGNSAGELCVFPFVFLGKQYSS
CTSDGRRDGRLWCATTSNFDTDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALMY
PLYSYLEGFPLNKDDIDGIQYLYGRGSKPDPRPPATTTTEPQPTAPPTMCPTIPPTAYPT
VGPTVGPTGAPSPGPTSSPSPGPTGAPSPGPTAPPTAGSSEASTESLSPADNPCNVDVFD
AIAEIQGALHFFKDGWYWKFLNHRGSPLQGPFLTARTWPALPATLDSAFEDPQTKRVFFF
SGRQMWVYTGKTVLGPRSLDKLGLGPEVTHVSGLLPRRLGKALLFSKGRVWRFDLKSQKV
DPQSVIRVDKEFSGVPWNSHDIFQYQDKAYFCHGKFFWRVSFQNEVNKVDHEVNQVDDVG
YVTYDLLQCP
NT seq 2193 nt NT seq  +upstreamnt  +downstreamnt
atgagtccctggcagcccctgctcctggctctcctggctttcggctgcagctctgctgcc
ccttaccagcgccagccgacttttgtggtcttccccaaagacctgaaaacctccaacctc
acggacacccagctggcagaggcatacttgtaccgctatggttacacccgggccgcccag
atgatgggagagaagcagtctctacggccggctttgctgatgcttcagaagcagctctcc
ctgccccagactggtgagctggacagccagacactaaaggccattcgaacaccacgctgt
ggtgtcccagacgtgggtcgattccaaaccttcaaaggcctcaagtgggaccatcataac
atcacatactggatccaaaactactctgaagacttgccgcgagacatgatcgatgacgcc
ttcgcgcgcgccttcgcggtgtggggcgaggtggcacccctcaccttcacccgcgtgtac
ggacccgaagcggacattgtcatccagtttggtgtcgcggagcacggagacgggtatccc
ttcgacggcaaggacggccttctggcacacgcctttccccctggcgccggcgttcaggga
gatgcccatttcgacgacgacgagttgtggtcgctgggcaaaggcgtcgtgatccccact
tactatggaaactcaaatggtgccccatgtcactttcccttcaccttcgagggacgctcc
tattcggcctgcaccacagacggccgcaacgacggcacgccttggtgtagcacaacagct
gactacgataaggacggcaaatttggtttctgccctagtgagagactctacacggagcac
ggcaacggagaaggcaaaccctgtgtgttcccgttcatctttgagggccgctcctactct
gcctgcaccactaaaggccgctcggatggttaccgctggtgcgccaccacagccaactat
gaccaggataaactgtatggcttctgccctacccgagtggacgcgaccgtagttgggggc
aactcggcaggagagctgtgcgtcttccccttcgtcttcctgggcaagcagtactcttcc
tgtaccagcgacggccgcagggatgggcgcctctggtgtgcgaccacatcgaacttcgac
actgacaagaagtggggtttctgtccagaccaagggtacagcctgttcctggtggcagcg
cacgagttcggccatgcactgggcttagatcattccagcgtgccggaagcgctcatgtac
ccgctgtatagctacctcgagggcttccctctgaataaagacgacatagacggcatccag
tatctgtatggtcgtggctctaagcctgacccaaggcctccagccaccaccacaactgaa
ccacagccgacagcacctcccactatgtgtcccactatacctcccacggcctatcccaca
gtgggccccacggttggccctacaggcgccccctcacctggccccacaagcagcccgtca
cctggccctacaggcgccccctcacctggccctacagcgccccctactgcgggctcttct
gaggcctctacagagtctttgagtccggcagacaatccttgcaatgtggatgtttttgat
gctattgctgagatccagggcgctctgcatttcttcaaggacggttggtactggaagttc
ctgaatcatagaggaagcccattacagggccccttccttactgcccgcacgtggccagcc
ctgcctgcaacgctggactccgcctttgaggatccgcagaccaagagggttttcttcttc
tctggacgtcaaatgtgggtgtacacaggcaagaccgtgctgggccccaggagtctggat
aagttgggtctaggcccagaggtaacccacgtcagcgggcttctcccgcgtcgtctcggg
aaggctctgctgttcagcaaggggcgtgtctggagattcgacttgaagtctcagaaggtg
gatccccagagcgtcattcgcgtggataaggagttctctggtgtgccctggaactcacac
gacatcttccagtaccaagacaaagcctatttctgccatggcaaattcttctggcgtgtg
agtttccaaaatgaggtgaacaaggtggaccatgaggtgaaccaggtggacgacgtgggc
tacgtgacctacgacctcctgcagtgcccttga

KEGG   Mus musculus (mouse): 83995Help
Entry
83995             CDS       T01002                                 

Gene name
Mmp1a, MMP-1a, Mcol-A, Mcola
Definition
(RefSeq) matrix metallopeptidase 1a (interstitial collagenase)
  KO
K01388  matrix metalloproteinase-1 (interstitial collagenase) [EC:3.4.24.7]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03320  PPAR signaling pathway
mmu04657  IL-17 signaling pathway
mmu04926  Relaxin signaling pathway
mmu05200  Pathways in cancer
mmu05219  Bladder cancer
mmu05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    83995 (Mmp1a)
  09152 Endocrine system
   03320 PPAR signaling pathway
    83995 (Mmp1a)
   04926 Relaxin signaling pathway
    83995 (Mmp1a)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    83995 (Mmp1a)
  09162 Cancer: specific types
   05219 Bladder cancer
    83995 (Mmp1a)
  09163 Immune disease
   05323 Rheumatoid arthritis
    83995 (Mmp1a)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    83995 (Mmp1a)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.7  interstitial collagenase
     83995 (Mmp1a)
Peptidases and inhibitors [BR:mmu01002]
 Metallo Peptidases
  Family M10
   83995 (Mmp1a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M10 Hemopexin PG_binding_1 Reprolysin_5 DUF4953 Metallopep Reprolysin_3 Reprolysin_4 Peptidase_M57
Motif
Other DBs
NCBI-GeneID: 83995
NCBI-ProteinID: NP_114395
MGI: 1933846
Ensembl: ENSMUSG00000043089
Vega: OTTMUSG00000062271
UniProt: Q9EPL5
LinkDB All DBs
Position
9; 9 A1
AA seq 464 aa AA seqDB search
MPSLPLLLLLWAASSYSFPVFHNGDRQNVETVWKYLENYYNLGKNMQAKNVNGKEMMAEK
LRQMQQLFGLKVTGNSDPETLRAMKKPRCGVPDVAPYAITHNNPRWTKTHLTYSILNYTP
YLPKAVVEDAIARAFRVWSDVTPLTFQRVFEEEGDIVLSFHRGDHGDNNPFDGPNYKLAH
TFQPGPGLGGDVHYDLDETWTNSSENFNLFYVTAHELGHSLGLTHSSDIGALMFPSYTWY
TEDFVLNQDDINRIQDLYGPSPNPIQPTGATTPHPCNGDLTFDAITTFRGEVFFFKGRFY
IRVNRFMPEPELNLIGILWPNLPVKLDAAYEASMIDQVRYFKGSKVWAVQEQSVLRGFPR
DIHSFFGFPSNVTHIDAAVCEEETGKTYFFVDHMYWRYDENTQSMDPGYPRLTAEDFPGI
DDKVDDVFQKGENFYFFHQSVQHRFNLQIRRVDDSRDSSTWFNC
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgcctagccttcctttgctgttgcttctctgggctgctagctcatacagtttccctgtg
tttcacaacggagaccggcaaaatgtggagacagtctggaaatacctggaaaactactac
aacttgggcaaaaacatgcaagctaaaaacgtgaatggcaaggagatgatggctgaaaag
ctgaggcaaatgcagcagttatttgggctgaaagtgactggaaattcagatcctgaaacc
ctgagagctatgaagaagcccaggtgtggggtgcctgatgtggccccatatgccattact
cacaacaatcctcgttggaccaaaacacatctgacatacagcattttaaactacacacca
tatttgccaaaagcagttgtggaagatgccatcgcgagagcctttagagtctggagtgat
gtgacaccacttacgttccaaagagtctttgaggaggaaggcgatattgtgctctccttc
cacagaggagaccatggtgacaacaacccatttgatggacctaactataagcttgctcac
actttccagccaggcccaggtttggggggtgatgttcattatgaccttgatgagacgtgg
accaacagcagtgaaaatttcaacttgttctatgttacggctcatgaactgggtcactcc
cttgggctcactcattctagtgatataggagcactaatgttccccagttacacgtggtac
actgaagactttgtgctaaaccaggatgatattaatcgcatccaggacttatatggacct
tccccaaatcccatccagccaacaggtgcaacaacaccacatccatgtaatggtgatcta
acctttgatgctataactacatttaggggagaggtgtttttcttcaaaggcaggttctac
attcgggtaaatagattcatgccagaacctgagctcaatttaataggtattctctggcca
aatcttccagttaaacttgacgctgcttatgaagctagtatgatagatcaagtccgctat
ttcaaaggcagcaaagtatgggctgttcaagagcagagtgtactgagaggattccccaga
gacatccacagtttctttggcttccctagcaatgtgacacacattgatgctgctgtttgt
gaggaagagactggaaaaacatacttctttgttgaccacatgtactggaggtatgatgaa
aatacacagtctatggatccaggttatcccagattaacagcagaagacttccctggaatt
gatgataaagttgatgatgttttccaaaaaggagaaaatttctatttctttcaccaatca
gttcaacacagatttaacctccaaataagaagagttgatgattcccgtgattctagtaca
tggttcaactgctaa

KEGG   Mus musculus (mouse): 83996Help
Entry
83996             CDS       T01002                                 

Gene name
Mmp1b, MMP-1b, Mcol-B, Mcolb
Definition
(RefSeq) matrix metallopeptidase 1b (interstitial collagenase)
  KO
K01388  matrix metalloproteinase-1 (interstitial collagenase) [EC:3.4.24.7]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03320  PPAR signaling pathway
mmu04657  IL-17 signaling pathway
mmu04926  Relaxin signaling pathway
mmu05200  Pathways in cancer
mmu05219  Bladder cancer
mmu05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    83996 (Mmp1b)
  09152 Endocrine system
   03320 PPAR signaling pathway
    83996 (Mmp1b)
   04926 Relaxin signaling pathway
    83996 (Mmp1b)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    83996 (Mmp1b)
  09162 Cancer: specific types
   05219 Bladder cancer
    83996 (Mmp1b)
  09163 Immune disease
   05323 Rheumatoid arthritis
    83996 (Mmp1b)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    83996 (Mmp1b)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.7  interstitial collagenase
     83996 (Mmp1b)
Peptidases and inhibitors [BR:mmu01002]
 Metallo Peptidases
  Family M10
   83996 (Mmp1b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M10 Hemopexin PG_binding_1 Metallopep Reprolysin_5 DUF4953 Peptidase_M54 Reprolysin_3 Reprolysin_4 Peptidase_M66 Reprolysin_2 Peptidase_M57
Motif
Other DBs
NCBI-GeneID: 83996
NCBI-ProteinID: NP_114396
MGI: 1933847
Ensembl: ENSMUSG00000041620
Vega: OTTMUSG00000027386
UniProt: G5E8A9
LinkDB All DBs
Position
9; 9 A1
AA seq 463 aa AA seqDB search
MSSLPLLLLLWAASSYSFPVIQDGLQKNVKTVWKYLENYYNLGKNMQAKNVNGKEVMAEK
LRQMQQLFGLKVTGNSDPETLRAMKKPRCGVPDVAPYAITHNNPRWTKTHLTYSILNYTP
YLSKAVVEDAIARAFRVWSDVTPLTFQRVFEEEGDIVLSFHRGDHGDLYTFDGSKYHFAH
AFLPGLGLGGNVHYDLDQKWTDNNEDFNLFYVTAHELGHSLGLSHSNDEEALMFPSYTWS
NKDFVLNQDDINRIQALYGPSPNPIQLTDATLDPCNSGLTFDAIITYRGEVIFFKDRFYI
RVISFLPEPLIDVIDLIWPNLPGKFDAAYEVSGVDELRFFKGSKVWAVQEQNVLEGFPMD
IQSFFGFPSNVTNIDAAVCEEETGKTYFFVDHMYWRYDENTRSMDPGYPRLIAEDFPGID
YKVDDVIQKEDNFYFFHQSIQYRFNLKTRRIDDSSDINTWFNC
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgtctagccttcctttgctgttgcttctctgggctgccagctcatacagtttccctgtg
attcaggatggactccagaaaaatgtgaagacagtctggaaatacctggaaaactactac
aacttgggcaaaaacatgcaagctaaaaacgtgaatggcaaggaggtgatggctgaaaag
ctgaggcaaatgcagcagttatttgggctgaaagtaactggaaattcagatcctgaaacc
ctgagagctatgaagaagcccaggtgtggggtgcctgatgtggccccatatgccattact
cacaacaatcctcgttggaccaaaacacatctgacttacagcattttaaactacacacca
tatttgtcaaaagcagttgtggaagatgccatcgcgagagcctttagagtctggagtgat
gtgacaccacttacgttccaaagagtctttgaggaggaaggcgatattgtgctctccttc
cacagaggagaccatggtgacctctacacatttgatggatctaaatatcactttgctcat
gcttttctgccaggcctaggtttggggggcaatgttcattatgatcttgatcagaagtgg
accgacaacaatgaggatttcaacttgttctatgttacggctcatgaactgggtcactcc
cttggactctcccattctaatgatgaagaggcactaatgttccccagctacacatggagc
aataaagactttgtgctaaaccaggatgatattaatcgcatccaggccttatatggacct
tccccaaatcccatccagttaacagatgcaacactggatccatgtaatagtggtctaacc
tttgatgctataattacatatcggggggaggtgatattctttaaagacaggttctacatt
cgggtaattagcttcctgccagaacctttgatcgatgtgatagaccttatctggccaaat
ctgccaggtaaatttgatgcagcttatgaagttagtggggtagatgaactccgctttttc
aaaggcagcaaagtatgggctgttcaggaacagaatgtactggaaggatttcccatggac
atccagagtttctttggcttccctagcaatgtgacaaacattgatgctgctgtttgtgaa
gaagagactggaaaaacatacttctttgttgaccacatgtactggagatatgatgaaaat
acacggtccatggatccaggttaccccagattaatagcagaagactttcctggaatcgac
tataaagttgatgatgttatccagaaagaggataatttctatttctttcaccaatcaatt
caatacagatttaacctcaaaacaagaagaattgatgattccagtgatattaatacttgg
ttcaactgctaa

DBGET integrated database retrieval system