KEGG   Mus musculus (mouse): 17685Help
Entry
17685             CDS       T01002                                 

Gene name
Msh2, AI788990
Definition
(RefSeq) mutS homolog 2
  KO
K08735  DNA mismatch repair protein MSH2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01524  Platinum drug resistance
mmu03430  Mismatch repair
mmu05200  Pathways in cancer
mmu05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    17685 (Msh2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    17685 (Msh2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    17685 (Msh2)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    17685 (Msh2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mmu03400]
    17685 (Msh2)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Mismatch and loop recognition factors
     17685 (Msh2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MutS_V MutS_III MutS_II MutS_I MutS_IV AAA_27
Motif
Other DBs
NCBI-GeneID: 17685
NCBI-ProteinID: NP_032654
MGI: 101816
Ensembl: ENSMUSG00000024151
Vega: OTTMUSG00000038134
UniProt: P43247 Q3TZI5
LinkDB All DBs
Position
17 E4; 17 57.87 cM
AA seq 935 aa AA seqDB search
MAVQPKETLQLEGAAEAGFVRFFEGMPEKPSTTVRLFDRGDFYTAHGEDALLAAREVFKT
QGVIKYMGPAGSKTLQSVVLSKMNFESFVKDLLLVRQYRVEVYKNKAGNKASKENEWYLA
FKASPGNLSQFEDILFGNNDMSASVGVMGIKMAVVDGQRHVGVGYVDSTQRKLGLCEFPE
NDQFSNLEALLIQIGPKECVLPGGETTGDMGKLRQVIQRGGILITERKRADFSTKDIYQD
LNRLLKGKKGEQINSAALPEMENQVAVSSLSAVIKFLELLSDDSNFGQFELATFDFSQYM
KLDMAAVRALNLFQGSVEDTTGSQSLAALLNKCKTAQGQRLVNQWIKQPLMDRNRIEERL
NLVEAFVEDSELRQSLQEDLLRRFPDLNRLAKKFQRQAANLQDCYRLYQGINQLPSVIQA
LEKYEGRHQALLLAVFVTPLIDLRSDFSKFQEMIETTLDMDQVENHEFLVKPSFDPNLSE
LREVMDGLEKKMQSTLINAARGLGLDPGKQIKLDSSAQFGYYFRVTCKEEKVLRNNKNFS
TVDIQKNGVKFTNSELSSLNEEYTKNKGEYEEAQDAIVKEIVNISSGYVEPMQTLNDVLA
HLDAIVSFAHVSNAAPVPYVRPVILEKGKGRIILKASRHACVEVQDEVAFIPNDVHFEKD
KQMFHIITGPNMGGKSTYIRQTGVIVLMAQIGCFVPCESAEVSIVDCILARVGAGDSQLK
GVSTFMAEMLETASILRSATKDSLIIIDELGRGTSTYDGFGLAWAISDYIATKIGAFCMF
ATHFHELTALANQIPTVNNLHVTALTTEETLTMLYQVKKGVCDQSFGIHVAELANFPRHV
IACAKQKALELEEFQNIGTSLGCDEAEPAAKRRCLEREQGEKIILEFLSKVKQVPFTAMS
EESISAKLKQLKAEVVAKNNSFVNEIISRIKAPAP
NT seq 2808 nt NT seq  +upstreamnt  +downstreamnt
atggcggtgcagcctaaggagacgctgcagttggaaggcgcggccgaggcgggcttcgtg
cgcttctttgagggcatgccggagaagccgagcaccacggtgcgcctcttcgaccgcggc
gacttttacacggcgcacggagaggacgcgctgctggcggcccgcgaggtgttcaagacc
cagggcgtgatcaagtacatggggccggcagggagtaagaccctgcagagtgttgtgctt
agcaagatgaactttgagtctttcgtgaaagatcttcttctggttcgccagtatcgagtt
gaagtttataagaataaagctggaaataaggcgtctaaggagaatgagtggtatctggca
tttaaggcttctcccggcaatctttctcagtttgaagacatcctgtttggtaacaatgac
atgtcagcttccgttggcgttatgggtattaaaatggccgtggttgatggtcaaagacat
gttggagttgggtatgtggattccacccagaggaagctaggcttgtgtgagttccccgag
aatgatcagttctccaatctcgaggctcttctgattcagattggaccaaaggaatgcgtt
ttaccaggaggagagactactggagacatggggaaactgaggcaggttatccagagagga
gggattctgatcacagaaagaaagagagccgacttttccactaaagacatttatcaggat
ctcaaccggttactgaaaggcaaaaaaggagaacagataaatagtgctgccctaccagag
atggagaatcaggttgcagtttcatcactatctgcagtaatcaagtttttagaactctta
tcagacgattcaaattttgggcagtttgaactggccacttttgacttcagccagtacatg
aagttggacatggcagcagttagagccctcaaccttttccagggttctgttgaagacacc
actggctctcagtctctggccgcattattgaataaatgcaaaactgctcaaggacaaaga
ttggttaaccagtggatcaagcagccgctcatggataggaacaggatagaggagaggtta
aatttagtggaagcttttgtcgaggattcagaactgaggcagagtttacaggaggatttg
cttcgccggtttccagaccttaaccggcttgccaagaaattccagagacaagcagcgaat
ttacaagactgttaccgactgtatcagggtattaaccagctccccagcgtcatccaggct
ctggagaaatacgaaggaagacaccaggcactgttgttggcagtttttgtgactcctctt
attgatcttcgttctgatttttcaaaatttcaagaaatgatagaaacaactttagatatg
gatcaggtggaaaaccacgagttccttgtaaaaccttcatttgatcctaacctgagtgaa
ctaagagaagtcatggatggcctggagaagaagatgcagtccaccttaataaatgcagcc
cgggggctcggattggatcctggcaaacagattaaattggactccagtgcacagtttgga
tattatttccgtgtaacctgcaaggaagagaaagtgcttcgcaacaacaagaacttcagc
acagtggacatccagaagaatggcgtgaagtttaccaacagtgaattgtcctctttaaat
gaagaatatactaagaacaaaggcgagtatgaagaggcccaggatgccattgttaaagaa
attgtcaatatttcctcaggctacgtagagccaatgcagacgctcaacgatgtgctggct
cacttagacgccattgttagcttcgctcatgtgtcaaacgcagcacccgttccttatgta
cgaccagtcatcttggagaaaggaaaagggagaattatattgaaagcctccaggcatgct
tgtgttgaagttcaagatgaagttgcatttattccaaatgacgtgcactttgaaaaagat
aaacagatgttccacatcattactggtcccaatatgggaggtaaatcaacatacattcgt
cagaccggggtgattgtactcatggcccaaatcgggtgttttgtgccctgtgagtcggca
gaagtgtccattgtggattgcatccttgctcgagtcggggctggtgacagtcaactgaaa
ggcgtctccacattcatggctgaaatgctggagactgcttccatcctcaggtcagcaacc
aaagactccttaataatcattgatgagctgggaagaggaacctctacctatgatggattt
gggttagcatgggctatatcagattacattgcaacgaagattggtgccttttgcatgttt
gccacccattttcatgaacttactgctttggccaaccaaataccaactgttaataatcta
catgtcacagcgctcactactgaggagaccctaactatgctttaccaagtgaaaaaaggt
gtctgtgatcagagtttcgggattcacgtggctgagctcgctaacttcccgaggcacgtg
atagcgtgcgccaagcagaaggctctagagcttgaagaatttcagaacattggaacctcg
ctgggatgtgacgaagccgagccggctgcaaagagacgctgcctggaaagagagcaaggt
gagaaaattattctggagttcctgtcgaaggtcaagcaggtgccctttactgccatgtcg
gaggagagcatctccgcgaagctgaagcaactgaaagccgaggtggtcgcaaagaacaac
agcttcgtaaacgagatcatttcacggataaaggctccggctccgtga

DBGET integrated database retrieval system