KEGG   Mus musculus (mouse): 17686Help
Entry
17686             CDS       T01002                                 

Gene name
Msh3, D13Em1, Rep-3, Rep3
Definition
(RefSeq) mutS homolog 3
  KO
K08736  DNA mismatch repair protein MSH3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01524  Platinum drug resistance
mmu03430  Mismatch repair
mmu05200  Pathways in cancer
mmu05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    17686 (Msh3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    17686 (Msh3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    17686 (Msh3)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    17686 (Msh3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mmu03400]
    17686 (Msh3)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Mismatch and loop recognition factors
     17686 (Msh3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MutS_V MutS_III MutS_II MutS_I MutS_IV NPV_P10
Motif
Other DBs
NCBI-GeneID: 17686
NCBI-ProteinID: NP_034959
MGI: 109519
Ensembl: ENSMUSG00000014850
Vega: OTTMUSG00000047254
UniProt: P13705 A0A087WQ16
LinkDB All DBs
Position
13 C3; 13 47.63 cM
AA seq 1095 aa AA seqDB search
MPRGKSASGGSTAAGPGPGRQTVLSRFFRSAGSLRSSASSTEPAEKVTEGDSRKRSLGNG
GPTKKKARKVPEKEEENISVAAHHPEAKKCLRPRIVLKSLEKLKEFCCDSALPQNRVQTE
ALRERLEVLPRCTDFEDITLQRAKNAVLSEDSKSQANQKDSQFGPCPEVFQKTSDCKPFN
KRSKSVYTPLELQYLDMKQQHKDAVLCVECGYKYRFFGEDAEIAARELNIYCHLDHNFMT
ASIPTHRLFVHVRRLVAKGYKVGVVKQTETAALKAIGDNKSSVFSRKLTALYTKSTLIGE
DVNPLIRLDDSVNIDEVMTDTSTNYLLCIYEEKENIKDKKKGNLSVGIVGVQPATGEVVF
DCFQDSASRLELETRISSLQPVELLLPSDLSVPTEMLIQRATNVSVRDDRIRVERMNNTY
FEYSHAFQTVTEFYAREIVDSQGSQSLSGVINLEKPVICALAAVIRYLKEFNLEKMLSKP
ESFKQLSSGMEFMRINGTTLRNLEILQNQTDMKTKGSLLWVLDHTKTSFGRRKLKNWVTQ
PLLKLREINARLDAVSDVLHSESSVFEQIENLLRKLPDVERGLCSIYHKKCSTQEFFLIV
KSLCQLKSELQALMPAVNSHVQSDLLRALIVEAPELLSPVEHYLKVLNGPAAKVGDKTEL
FKDLSDFPLIKKRKNEIQEVIHSIQMRLQEFRKILKLPSLQYVTVSGQEFMIEIKNSAVS
CIPADWVKVGSTKAVSRFHPPFIVESYRRLNQLREQLVLDCNAEWLGFLENFGEHYHTLC
KAVDHLATVDCIFSLAKVAKQGNYCRPTLQEEKKIIIKNGRHPMIDVLLGEQDQFVPNST
SLSQDSERVMIITGPNMGGKSSYIKQVALVTIMAQIGSYVPAEEATIGIVDGIFTRMGAA
DNIYKGRSTFMEELTDTAEIIRRASPQSLVILDELGRGTSTHDGIAIAYATLEYFIRDVK
SLTLFVTHYPPVCELEKCYPEQVGNYHMGFLVNEDESKQDSGDMEQMPDSVTFLYQITRG
IAARSYGLNVAKLADVPREVLQKAAHKSKELEGLVSLRRKRLECFTDLWTTHSVKDLHTW
ADKLEMEEIQTSLPH
NT seq 3288 nt NT seq  +upstreamnt  +downstreamnt
atgccccgcgggaaatccgcgtcgggaggctctactgccgccggcccaggcccggggagg
caaacggttctaagccggttcttcaggtctgcgggaagcctaagatccagcgcgtcctcc
acggagccagcagagaaggtgacagaaggtgacagcaggaagaggtcactgggaaatggt
gggcccactaagaaaaaagcaaggaaagttccagagaaggaggaagaaaacatctcagta
gcagctcaccaccctgaggcaaagaaatgtctgaggcccaggattgttttaaagtccctg
gaaaagttgaaagaattctgctgtgattctgccctccctcaaaacagagtccagacagaa
gctcttcgggagagacttgaagttctgccaaggtgtactgattttgaagatatcactctg
caacgtgcaaagaatgcggttttgtccgaagattccaaatctcaggctaatcagaaagac
agtcaatttggaccctgccctgaagttttccagaagacttccgattgtaaaccttttaac
aagcgatccaagagcgtctatacaccgttagaactgcagtacttagatatgaagcagcag
cataaagacgcagttttgtgtgtggagtgtggttacaagtacagattctttggggaagat
gcagaaattgctgcccgggaactcaatatttattgccacttagaccacaactttatgact
gcaagcatacctacccacagactgttcgtgcatgtccgccgacttgtggccaaagggtac
aaggtgggagttgtgaagcaaactgaaactgccgcattaaaggccatcggagacaataaa
agttctgtcttctcccggaaattgaccgctctttatacgaaatccacacttattggtgaa
gatgtgaatcctctcatcaggctggatgattctgtaaatatcgatgaggtaatgacagat
acatctaccaactatcttctgtgtatctacgaagaaaaggagaacattaaagacaaaaag
aaggggaacctttccgttggtatcgtgggagtgcagcccgcaactggcgaggttgtgttt
gactgcttccaggactctgcttccagactggagctggagactcgcatatcaagcctgcag
cctgtggaattactgcttccctccgacctgtctgtgccaacagagatgctcatccaaaga
gccaccaatgtcagtgtgcgggatgacaggattcgagtagaaaggatgaataatacttac
tttgaatacagccatgctttccagacagttacggagttttatgctagagagatagttgac
agccagggctctcagagtctctctggtgtcattaacttggagaagcctgtgatctgcgcc
ttggctgccgtaataaggtacctcaaggaatttaacctggaaaagatgctgtccaaaccc
gagagttttaaacagctgtcaagtggaatggaattcatgagaattaatgggaccacgcta
aggaatctggagatccttcagaatcagactgatatgaagaccaaaggaagcttgctttgg
gttttagaccacactaaaacttcatttgggagaaggaagttaaagaattgggttacccag
ccactgcttaaattaagggaaataaatgcccgacttgatgcagtatctgatgttctccac
tcagaatccagtgtgtttgagcagatagaaaaccttcttcgtaagttaccggatgtcgag
agaggactatgtagcatttatcacaagaagtgctctacccaagagttcttcttgatcgtc
aaaagcctatgtcaactgaagtcagagcttcaagcattaatgcctgctgttaattcccac
gttcagtccgacttactccgagcactcatcgtggaggctcctgagctcctcagcccagtg
gaacattacttaaaggttctgaatgggccagctgccaaagttggcgataaaactgaatta
ttcaaagacctctctgacttccctttaataaaaaagaggaaaaatgaaattcaggaagtc
attcacagcatccaaatgcgtttacaggaatttcggaaaatattaaaacttccttcttta
cagtatgtgactgtatcaggacaagagtttatgattgaaataaagaactcggctgtatct
tgcatcccagctgattgggtgaaggttggaagcacaaaagctgtgagccgctttcaccct
cccttcatcgtggaaagctacagacgtctgaatcagctccgggagcagctagtccttgac
tgcaatgctgaatggcttggcttcctagagaattttggtgaacattatcacactttgtgt
aaggctgtggatcacctagcaactgttgactgtattttctccctggccaaggtcgctaaa
caaggaaattactgcaggccaactctacaagaagaaaagaagatcatcataaaaaatgga
aggcaccctatgattgatgtgttgctgggtgaacaagatcagtttgtgcccaacagtacg
agtttatcacaggactcggagagagtaatgataatcaccggaccaaacatgggtgggaaa
agctcctacataaaacaggttgcactggttaccatcatggctcagattggctcctacgtc
cctgcagaggaagccacaattgggattgtggatggcattttcacaaggatgggtgctgca
gacaatatatacaaaggccggagtactttcatggaagaactgacggacacagcggaaata
atcaggagagcgtccccacagtccttggttatcctggatgagctggggagagggacaagc
acccatgacggaatcgccatcgcctatgcaactctagagtattttatcagagacgtgaaa
tccttaacactgttcgttacccactatccaccagtctgtgaactagaaaaatgttaccca
gaacaagtggggaattaccacatgggattcttggtcaatgaagatgaaagcaagcaggac
tcaggtgacatggagcagatgccggattctgtcacttttctctatcagataacccgagga
attgcagcgagaagttatggacttaatgtggcgaagttagcagatgtacctagagaagtc
ttacagaaagccgcgcacaagtctaaggagctggaaggcttagtcagcctgagaaggaaa
aggcttgaatgttttaccgacttatggacgacacacagtgtgaaggacctgcacacatgg
gcagataagctggaaatggaggaaatacagacttctctcccacattaa

DBGET integrated database retrieval system