KEGG   Mus musculus (mouse): 17688Help
Entry
17688             CDS       T01002                                 

Gene name
Msh6, AU044881, AW550279, GTBP, Gtmbp
Definition
(RefSeq) mutS homolog 6
  KO
K08737  DNA mismatch repair protein MSH6
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01524  Platinum drug resistance
mmu03430  Mismatch repair
mmu05200  Pathways in cancer
mmu05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    17688 (Msh6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    17688 (Msh6)
  09162 Cancer: specific types
   05210 Colorectal cancer
    17688 (Msh6)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    17688 (Msh6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mmu03400]
    17688 (Msh6)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Mismatch and loop recognition factors
     17688 (Msh6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MutS_V MutS_III MutS_I PWWP MutS_IV MutS_II
Motif
Other DBs
NCBI-GeneID: 17688
NCBI-ProteinID: NP_034960
MGI: 1343961
Ensembl: ENSMUSG00000005370
UniProt: P54276
LinkDB All DBs
Position
17 E4; 17 57.87 cM
AA seq 1358 aa AA seqDB search
MSRQSTLYSFFPKSPALGDTKKAAAEASRQGAAASGASASRGGDAAWSEAEPGSRSAAVS
ASSPEAKDLNGGLRRASSSAQAVPPSSCDFSPGDLVWAKMEGYPWWPCLVYNHPFDGTFI
RKKGKSVRVHVQFFDDSPTRGWVSKRMLKPYTGSKSKEAQKGGHFYSSKSEILRAMQRAD
EALSKDTAERLQLAVCDEPSEPEEEEETEVHEAYLSDKSEEDNYNESEEEAQPSVQGPRR
SSRQVKKRRVISDSESDIGGSDVEFKPDTKQEGSSDDASSGVGDSDSEDLGTFGKGAPKR
KRAMVAQGGLRRKSLKKETGSAKRATPILSETKSTLSAFSAPQNSESQTHVSGGGNDSSG
PTVWYHETLEWLKPEKRRDEHRRRPDHPEFNPTTLYVPEEFLNSCTPGMRKWWQLKSQNF
DLVIFYKVGKFYELYHMDAVIGVSELGLIFMKGNWAHSGFPEIAFGRFSDSLVQKGYKVA
RVEQTETPEMMEARCRKMAHVSKFDRVVRREICRIITKGTQTYSVLDGDPSENYSRYLLS
LKEKEEETSGHTRVYGVCFVDTSLGKFFIGQFSDDRHCSRFRTLVAHYPPVQILFEKGNL
STETKTVLKGSLSSCLQEGLIPGSQFWDATKTLRTLLEGGYFTGNGDSSTVLPLVLKGMT
SESDSVGLTPGEESELALSALGGIVFYLKKCLIDQELLSMANFEEYFPLDSDTVSTVKPG
AVFTKASQRMVLDAVTLNNLEIFLNGTNGSTEGTLLERLDTCHTPFGKRLLKQWLCAPLC
SPSAISDRLDAVEDLMAVPDKVTEVADLLKKLPDLERLLSKIHNVGSPLKSQNHPDSRAI
MYEETTYSKKKIIDFLSALEGFKVMCKVSGLLEEVAGGFTSKTLKQVVTLQSKSPKGRFP
DLTAELQRWDTAFDHEKARKTGLITPKAGFDSDYDQALADIRENEQSLLEYLDKQRSRLG
CKSIVYWGIGRNRYQLEIPENFATRNLPEEYELKSTKKGCKRYWTKTIEKKLANLINAEE
RRDTSLKDCMRRLFCNFDKNHKDWQSAVECIAVLDVLLCLANYSQGGDGPMCRPEIVLPG
EDTHPFLEFKGSRHPCITKTFFGDDFIPNDILIGCEEEAEEHGKAYCVLVTGPNMGGKST
LIRQAGLLAVMAQLGCYVPAEKCRLTPVDRVFTRLGASDRIMSGESTFFVELSETASILR
HATAHSLVLVDELGRGTATFDGTAIANAVVKELAETIKCRTLFSTHYHSLVEDYSKSVCV
RLGHMACMVENECEDPSQETITFLYKFIKGACPKSYGFNAARLANLPEEVIQKGHRKARE
FERMNQSLQLFREVCLATEKPTINGEAIHRLLALINGL
NT seq 4077 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgacaaagcaccttgtacagcttcttccccaagtccccggcactcggcgacacc
aagaaggccgcggccgaggcctcacgccaaggtgccgctgcctctggagcctccgcttcc
cgcggcggggatgcggcctggagcgaggctgaacccgggtcccggtccgcggcggtatcc
gcctcgtcgccggaggcaaaggatctcaacggagggctgcggagggcctcctcctccgcg
caggccgtgcctcccagttcttgtgacttctcaccaggtgatttggtttgggctaagatg
gaaggttacccctggtggccttgcctagtttataatcatccctttgatggaacgttcatc
cggaagaaagggaaatctgtccgtgttcatgtacagttctttgatgacagcccaacaagg
ggctgggttagcaaaaggatgttaaagccatatacaggttcaaagtcaaaggaagcccaa
aagggaggtcatttctacagttcaaagtctgagatactcagagcaatgcaacgtgcagat
gaggccttaagtaaagacacggctgagaggctgcagctggcagtgtgtgatgagccttca
gagccggaggaggaggaggagacagaggtgcatgaggcttatttatctgataagagtgaa
gaggataattacaacgagagtgaagaagaagcacagcccagtgttcaggggcctaggcga
agcagccggcaagtcaagaagcgacgggtcatctcagactcggagagtgacattggtggc
tctgatgtagaattcaagccagacactaagcaggaaggaagcagtgatgacgcgagcagt
ggagttggggacagcgatagtgaggacctaggcacctttggcaaaggcgctccaaagcgg
aagagagccatggttgctcagggtggacttagaaggaaaagtctgaagaaggaaacaggc
tcagccaaacgagcaactcccattctctcagaaaccaagagtaccttgagcgctttttct
gcccctcagaattctgaatcccagacccacgtcagtggaggaggtaacgacagtagtgga
cccactgtttggtatcacgaaactttagaatggcttaagccagaaaagagaagagatgag
cacaggagacgccccgatcaccctgaatttaaccccaccacactgtatgtgcctgaagag
ttcctcaattcttgtaccccagggatgaggaagtggtggcagctcaagtctcagaacttt
gacctcgtcatcttttataaggtggggaagttttatgagttgtatcacatggatgctgtt
attggagtcagtgagctggggctgatattcatgaagggcaactgggcccattctggtttt
ccagagattgcgtttggccggttctcggattccttggtgcagaagggctataaggtagca
cgagtggagcagaccgagactccagaaatgatggaggcgcgatgtcggaaaatggcacac
gtgtccaagtttgatagagtggtgagaagggagatttgcaggatcattaccaagggcaca
cagacctacagtgtgctggatggtgatccctctgagaactacagtaggtatcttcttagc
ctcaaagagaaggaggaagagacttctggtcacactcgtgtgtatggtgtttgctttgtg
gacacttcactgggcaagtttttcatcggccagttttcggatgaccgccactgttccaga
tttaggacgctagtggctcactatcctccagtacaaattttgttcgagaaaggaaatctc
tcaacagagaccaaaactgtcctaaagggttcactgtcatcttgtcttcaggaaggtctc
ataccaggttcccaattttgggatgccactaagaccttgcgaacactccttgaaggaggg
tactttactggaaatggagacagtagtacagtgctgcctctggtgcttaaaggaatgacc
tcggagtcagattctgttgggttgacaccaggcgaggagagtgaattggctctctctgct
ctaggtggtattgttttctacctcaaaaaatgcctgattgatcaggagcttctgtcaatg
gctaattttgaagagtatttccctttggattctgacacggtcagcacagtaaaacctggg
gctgtctttactaaagccagtcagcggatggtgctagacgcagtgacattaaacaacctg
gagattttcctgaatgggacaaatggctctactgaagggaccctgctagagagattggat
acttgccatacgccctttggcaagcggctcttaaaacagtggctctgtgcccccctctgc
agcccttctgccatcagtgaccgtctagatgcggtggaagatctgatggccgtgcctgac
aaggtcactgaagttgcagacctcttaaagaagctgccagaccttgagaggctactgagt
aagattcataatgttgggtctcccctgaagagccagaaccatccagacagcagggctata
atgtacgaagaaacgacatacagcaaaaagaagatcattgattttctctctgctctagaa
ggattcaaagtaatgtgtaaagtctcagggcttctggaggaggtcgcgggtggttttacg
tccaaaaccctcaagcaggttgttactctgcagtcaaaaagtcctaaaggccgctttcct
gacctgactgcagaactgcagcgatgggacacagcctttgaccatgagaaggctcggaag
accggactcatcactccaaaagcagggtttgactctgattatgaccaagcacttgctgac
atcagagagaatgaacagagcctcctggagtacttagacaaacagcgcagtcggcttggc
tgtaagagcatagtctactggggaatcggtaggaaccgttaccagttagagattccagag
aatttcgctacccgtaatctacctgaagaatatgagctgaaatctactaaaaaaggctgt
aaacgatactggaccaaaacgattgagaagaaattagctaatcttattaatgctgaagaa
cgcagggacacatccttaaaggactgcatgcggcgcttgttctgtaacttcgacaagaac
cacaaggactggcagtctgctgtagagtgcattgcagtgttggatgtcttactgtgcctg
gctaactacagtcaaggaggagatggtcctatgtgtcgcccagaaattgtgttaccagga
gaagacacacatcccttcttagagtttaaagggtcacgacatccctgcattacaaagact
ttttttggagacgattttattcctaacgacattctaataggctgcgaggaagaagcagag
gaacatggcaaagcctattgtgtgcttgtgactggaccaaatatggggggcaagtctaca
ctcataagacaggctggtctgttggctgtgatggcccagctgggttgttacgtacctgct
gagaagtgcaggctcacaccagttgacagagtgtttactaggcttggtgcctcagataga
ataatgtcaggagaaagcacattttttgttgagttgagtgaaactgctagcatactcagg
catgcaacagcacattctttggtacttgtggatgaattaggaagaggcaccgcaactttt
gatgggacagcgatagccaatgcggttgttaaagaacttgctgaaaccataaagtgtcga
acactgttttctacacactatcattcattagtagaagattattctaaaagtgtttgtgtg
cgcctaggacatatggcatgcatggtagaaaatgaatgtgaggaccccagccaggagact
attactttcctctataaattcattaagggagcttgtcctaagagctatggctttaatgca
gcaaggcttgctaatctcccggaggaggttattcagaagggacacagaaaggcaagagaa
tttgagaggatgaatcagtcattacagctatttcgggaagtttgtctggctactgaaaag
ccgactataaacggtgaagctatccataggctgctggccttgattaacggattgtag

DBGET integrated database retrieval system