KEGG   Mus musculus (mouse): 17857
Entry
17857             CDS       T01002                                 

Gene name
Mx1, AI893580, Mx, Mx-1
Definition
(RefSeq) MX dynamin-like GTPase 1
  KO
K14754  interferon-induced GTP-binding protein Mx
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05160  Hepatitis C
mmu05162  Measles
mmu05164  Influenza A
mmu05165  Human papillomavirus infection
mmu05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    17857 (Mx1)
   05171 Coronavirus disease - COVID-19
    17857 (Mx1)
   05164 Influenza A
    17857 (Mx1)
   05162 Measles
    17857 (Mx1)
   05165 Human papillomavirus infection
    17857 (Mx1)
SSDB
Motif
Pfam: Dynamin_M Dynamin_N GED MMR_HSR1 AAA_21 AAA_29 AAA_16 CDKN3 ABC_tran
Other DBs
NCBI-GeneID: 17857
NCBI-ProteinID: NP_034976
MGI: 97243
Ensembl: ENSMUSG00000000386
Vega: OTTMUSG00000016636
UniProt: P09922 Q4FJJ9
LinkDB
Position
16 C4; 16 57.46 cM
AA seq 631 aa
MDSVNNLCRHYEEKVRPCIDLIDTLRALGVEQDLALPAIAVIGDQSSGKSSVLEALSGVA
LPRGSGIVTRCPLVLKLRKLKEGEEWRGKVSYDDIEVELSDPSEVEEAINKGQNFIAGVG
LGISDKLISLDVSSPNVPDLTLIDLPGITRVAVGNQPADIGRQIKRLIKTYIQKQETINL
VVVPSNVDIATTEALSMAQEVDPEGDRTIGVLTKPDLVDRGAEGKVLDVMRNLVYPLKKG
YMIVKCRGQQDIQEQLSLTEAFQKEQVFFKDHSYFSILLEDGKATVPCLAERLTEELTSH
ICKSLPLLEDQINSSHQSASEELQKYGADIPEDDRTRMSFLVNKISAFNRNIMNLIQAQE
TVSEGDSRLFTKLRNEFLAWDDHIEEYFKKDSPEVQSKMKEFENQYRGRELPGFVDYKAF
ESIIKKRVKALEESAVNMLRRVTKMVQTAFVKILSNDFGDFLNLCCTAKSKIKEIRLNQE
KEAENLIRLHFQMEQIVYCQDQVYKETLKTIREKEAEKEKTKALINPATFQNNSQFPQKG
LTTTEMTQHLKAYYQECRRNIGRQIPLIIQYFILKTFGEEIEKMMLQLLQDTSKCSWFLE
EQSDTREKKKFLKRRLLRLDEARQKLAKFSD
NT seq 1896 nt   +upstreamnt  +downstreamnt
atggattctgtgaataatctgtgcaggcactatgaggagaaggtgcggccctgtattgac
ctcatcgacaccctgagggctctgggtgtggagcaggacctggccctgcctgccatcgct
gtcattggggaccagagttcagggaagagctctgttctggaagcactgtctggagtggcc
ctccccagaggcagtggtattgtcaccagatgccctctggtgctgaaattgaggaagctg
aaagaaggagaggagtggagaggcaaagtctcctatgatgacatcgaagtggagctctct
gatccttcagaggtggaagaggccattaacaagggtcagaacttcattgctggggtaggc
ctggggatcagtgataagctcattagcctggatgtcagctccccaaatgtcccagacctg
actctcattgacctgcctggaattaccagggtggctgtaggcaaccagcctgcagacata
ggacgccagatcaagagacttatcaagacatacatccaaaaacaagagaccatcaacctg
gtggtagtccccagcaatgtggacattgctaccacagaggctctgagcatggctcaggag
gtggaccctgaaggggataggaccataggggtcttgaccaagcctgatctggtggacaga
ggtgctgaaggcaaggtcttggatgtgatgcggaacctggtgtatcctctgaagaagggc
tacatgatagtcaagtgcagaggtcagcaggacatccaagagcagctgagcctgactgag
gcttttcagaaagagcaagtcttcttcaaggatcactcatacttcagcattcttctggaa
gatgggaaggccacagtgccctgcctggcagagagactgactgaggagctcacctcccac
atctgtaaatcactgccactattggaagatcaaataaatagcagtcatcagagtgcaagc
gaggagctgcagaagtacggtgcagacataccagaagatgacagaacgaggatgtccttt
ctggtgaataaaatcagtgccttcaataggaatatcatgaatttgatacaagcacaggaa
accgtatcagagggagacagccggttgtttaccaaactgcgaaatgagtttcttgcttgg
gatgatcatattgaggaatattttaaaaaagattctcctgaggtacaaagcaagatgaaa
gaatttgaaaatcagtatcgtggccgggagctgccagggtttgtggactacaaggcattt
gagagcatcatcaaaaagcgagtcaaagccctggaagagtctgctgtgaacatgctgcgc
agggtcactaagatggtccaaactgccttcgtaaagattttatcaaatgattttggtgat
tttttaaacctctgctgtactgctaagtccaaaattaaagaaataagattaaaccaagaa
aaggaagctgaaaacctgatccgacttcacttccagatggaacagattgtctactgccag
gaccaggtttacaaggaaaccttgaagacgatcagagagaaggaagctgagaaagagaag
accaaggcattaataaaccctgctacctttcaaaataactctcagtttcctcaaaagggg
ttgactaccactgagatgacccagcacctgaaagcctactaccaggagtgcagacggaat
attgggagacagatccctctgattatccagtacttcatcctgaaaacatttggggaggaa
atagagaaaatgatgcttcagcttttacaggacaccagtaagtgcagctggttcctggag
gagcagagtgacaccagagagaagaagaagttcctgaaaaggcggcttttaaggctggat
gaggctcggcagaagcttgccaaattctccgattaa

KEGG   Mus musculus (mouse): 17858
Entry
17858             CDS       T01002                                 

Gene name
Mx2, AI528743, Mx-2
Definition
(RefSeq) MX dynamin-like GTPase 2
  KO
K14754  interferon-induced GTP-binding protein Mx
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05160  Hepatitis C
mmu05162  Measles
mmu05164  Influenza A
mmu05165  Human papillomavirus infection
mmu05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    17858 (Mx2)
   05171 Coronavirus disease - COVID-19
    17858 (Mx2)
   05164 Influenza A
    17858 (Mx2)
   05162 Measles
    17858 (Mx2)
   05165 Human papillomavirus infection
    17858 (Mx2)
SSDB
Motif
Pfam: Dynamin_M Dynamin_N GED MMR_HSR1 AAA_21 AAA_29 ABC_tran CHDNT AAA_16
Other DBs
NCBI-GeneID: 17858
NCBI-ProteinID: NP_038634
MGI: 97244
Ensembl: ENSMUSG00000023341
Vega: OTTMUSG00000047542
UniProt: Q9WVP9
LinkDB
Position
16 C4; 16 57.51 cM
AA seq 655 aa
MVLSTEENTGVDSVNLPSGETGLGEKDQESVNNLCSQYEEKVRPCIDLIDSLRALGVEQD
LALPAIAVIGDQSSGKSSVLEALSGVALPRGSGIVTRCPLVLKLRKLNEGEEWRGKVSYD
DIEVELSDPSEVEEAINKGQNFIAGVGLGISDKLISLDVSSPNVPDLTLIDLPGITRVAV
GNQPADIGRQIKRLIKTYIQKQETINLVVVPSNVDIATTEALSMAQEVDPEGDRTIGILT
KPDLVDRGTEDKVVDVVRNLVYHLKKGYMIVKCRGQQDIQEQLSLTEALQNEQIFFKEHP
HFRVLLEDGKATVPCLAERLTAELILHICKSLPLLENQIKESHQSASEELQKYGMDIPED
DSEKTFFLIEKINAFNQDITALVQGEENVAEGECRLFTRLRKEFLSWSKEIEKNFAKGYA
VLYNEVWAFEKQYRGRELPGFVNYKTFENIIRRQIKTLEEPAIEMLHTVTEIVRAAFTSV
SEKNFSEFYNLHRTTKSKLEDIRLEQEKEAEMSIRLHFKMEQIIYCQDQIYRGALQKVRE
EEAEEEKKTKHGTSSSSQSQDLQTSSMAEIFQHLNAYRQEAHNRISSHVPLIIQYFILKM
FAERLQKGMLQLLQDKDSCSWLLKEQSDTSEKRKFLKERLARLAQARRRLAKFPG
NT seq 1968 nt   +upstreamnt  +downstreamnt
atggttcttagcacagaagaaaacacaggcgttgattcagtcaacttacccagtggagag
acgggcctaggagagaaagaccaggagtctgtgaacaatctctgcagtcagtatgaggag
aaggtgcggccctgcattgacctcatcgactccctgcgggctctgggtgtggagcaggac
ctggccctgcctgccatcgctgtcattggggaccagagttcagggaagagctctgtgctg
gaagcactgtctggagtggccctccccagaggcagtggtattgtcaccagatgccctctg
gtgctgaaattgaggaagctgaatgagggagaggagtggagaggcaaagtctcctatgat
gacatcgaagtggagctctctgatccttcagaggtggaagaggccatcaacaagggtcag
aacttcattgctggggtaggtctggggatcagtgataagctcattagcctggatgtcagc
tccccaaatgtcccagacctgactctcattgacctgcctggaattaccagggtggctgta
ggcaaccagcctgcagacataggacgccagatcaagagactcatcaagacatacatccaa
aaacaggagaccatcaacctggtggtggtccccagcaatgtggacattgccaccacagag
gctctgagcatggctcaggaggtggaccctgaaggggataggaccatagggatcttgacc
aagcccgatctggtggacagaggtactgaagacaaggtcgtggatgtggtgcggaacctg
gtgtaccatctgaagaagggctacatgatagtcaagtgcagaggccagcaggacatccaa
gagcagctgagcctgactgaggctcttcagaatgagcaaatcttcttcaaggaacaccct
catttcagagttcttctggaggatgggaaggccacagtgccctgcctggcagagagactg
accgcagagctcatcttacacatctgtaaatctcttcctctgctagaaaatcaaataaag
gaaagtcaccagagtgcaagtgaggagctgcagaagtacggtatggacataccagaagat
gacagtgaaaaaacgttcttcctgattgaaaaaatcaatgcttttaaccaggacatcact
gccctagtacaaggggaagagaatgtggcagagggagaatgtcgcctattcaccaggctc
cgaaaagagttcttgtcctggagtaaggagatcgaaaagaatttcgcaaaaggttatgct
gttttatataatgaagtctgggcatttgaaaagcagtaccgtggacgagaattgccaggg
tttgtgaattacaaaacatttgagaacattataagaagacaaatcaaaaccctggaagaa
ccagctatagaaatgctgcacacggtcactgaaattgtacgagctgcctttacaagtgtt
tctgagaaaaatttttctgagttttataacctccacagaactaccaagtccaaacttgaa
gacatcagattagaacaagaaaaggaagcagagatgtcaatccgactccacttcaagatg
gaacaaattatctactgccaggaccagatttacagaggagccttgcagaaggtcagagag
gaggaagctgaggaggagaagaagacaaagcatggcacttccagttcctctcagtcccaa
gatttacagacctcatccatggctgagatcttccagcatctgaatgcctaccgccaagag
gctcacaaccgcatctccagccacgttcccttgatcatccagtatttcatcctgaaaatg
tttgctgagcggctgcagaagggcatgctccagctcctgcaggacaaggattcctgcagc
tggctcctgaaggagcagagtgacacaagcgagaagaggaagttcctgaaggagaggctg
gcaaggctggcccaggctcggcgccggctagccaaattccctggttaa

DBGET integrated database retrieval system