KEGG   Mus musculus (mouse): 17869Help
Entry
17869             CDS       T01002                                 

Gene name
Myc, AU016757, Myc2, Niard, Nird, bHLHe39
Definition
(RefSeq) myelocytomatosis oncogene
  KO
K04377  Myc proto-oncogene protein
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04012  ErbB signaling pathway
mmu04110  Cell cycle
mmu04151  PI3K-Akt signaling pathway
mmu04218  Cellular senescence
mmu04310  Wnt signaling pathway
mmu04350  TGF-beta signaling pathway
mmu04390  Hippo signaling pathway
mmu04550  Signaling pathways regulating pluripotency of stem cells
mmu04630  Jak-STAT signaling pathway
mmu04919  Thyroid hormone signaling pathway
mmu05160  Hepatitis C
mmu05161  Hepatitis B
mmu05163  Human cytomegalovirus infection
mmu05166  Human T-cell leukemia virus 1 infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05169  Epstein-Barr virus infection
mmu05200  Pathways in cancer
mmu05202  Transcriptional misregulation in cancer
mmu05205  Proteoglycans in cancer
mmu05206  MicroRNAs in cancer
mmu05210  Colorectal cancer
mmu05213  Endometrial cancer
mmu05216  Thyroid cancer
mmu05219  Bladder cancer
mmu05220  Chronic myeloid leukemia
mmu05221  Acute myeloid leukemia
mmu05222  Small cell lung cancer
mmu05224  Breast cancer
mmu05225  Hepatocellular carcinoma
mmu05226  Gastric cancer
mmu05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    17869 (Myc)
   04012 ErbB signaling pathway
    17869 (Myc)
   04310 Wnt signaling pathway
    17869 (Myc)
   04350 TGF-beta signaling pathway
    17869 (Myc)
   04390 Hippo signaling pathway
    17869 (Myc)
   04630 Jak-STAT signaling pathway
    17869 (Myc)
   04151 PI3K-Akt signaling pathway
    17869 (Myc)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    17869 (Myc)
   04218 Cellular senescence
    17869 (Myc)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    17869 (Myc)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    17869 (Myc)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    17869 (Myc)
   05202 Transcriptional misregulation in cancer
    17869 (Myc)
   05206 MicroRNAs in cancer
    17869 (Myc)
   05205 Proteoglycans in cancer
    17869 (Myc)
   05230 Central carbon metabolism in cancer
    17869 (Myc)
  09162 Cancer: specific types
   05210 Colorectal cancer
    17869 (Myc)
   05225 Hepatocellular carcinoma
    17869 (Myc)
   05226 Gastric cancer
    17869 (Myc)
   05216 Thyroid cancer
    17869 (Myc)
   05221 Acute myeloid leukemia
    17869 (Myc)
   05220 Chronic myeloid leukemia
    17869 (Myc)
   05219 Bladder cancer
    17869 (Myc)
   05213 Endometrial cancer
    17869 (Myc)
   05224 Breast cancer
    17869 (Myc)
   05222 Small cell lung cancer
    17869 (Myc)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    17869 (Myc)
   05161 Hepatitis B
    17869 (Myc)
   05160 Hepatitis C
    17869 (Myc)
   05163 Human cytomegalovirus infection
    17869 (Myc)
   05167 Kaposi sarcoma-associated herpesvirus infection
    17869 (Myc)
   05169 Epstein-Barr virus infection
    17869 (Myc)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    17869 (Myc)
   03019 Messenger RNA biogenesis [BR:mmu03019]
    17869 (Myc)
Transcription factors [BR:mmu03000]
 Eukaryotic Type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Cell cycle controlling factors, Myc
    17869 (Myc)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     17869 (Myc)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myc_N Myc-LZ HLH
Motif
Other DBs
NCBI-GeneID: 17869
NCBI-ProteinID: NP_001170823
MGI: 97250
Ensembl: ENSMUSG00000022346
Vega: OTTMUSG00000034892
UniProt: P01108 B2RSN1
LinkDB All DBs
Position
15 D1; 15 26.19 cM
AA seq 439 aa AA seqDB search
MPLNVNFTNRNYDLDYDSVQPYFICDEEENFYHQQQQSELQPPAPSEDIWKKFELLPTPP
LSPSRRSGLCSPSYVAVATSFSPREDDDGGGGNFSTADQLEMMTELLGGDMVNQSFICDP
DDETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDSTSLSPARGHSVCSTSSLYLQ
DLTAAASECIDPSVVFPYPLNDSSSPKSCTSSDSTAFSPSSDSLLSSESSPRASPEPLVL
HEETPPTTSSDSEEEQEDEEEIDVVSVEKRQTPAKRSESGSSPSRGHSKPPHSPLVLKRC
HVSTHQHNYAAPPSTRKDYPAAKRAKLDSGRVLKQISNNRKCSSPRSSDTEENDKRRTHN
VLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSIQADEHKLTSEKDLL
RKRREQLKHKLEQLRNSGA
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgcccctcaacgtgaacttcaccaacaggaactatgacctcgactacgactccgtacag
ccctatttcatctgcgacgaggaagagaatttctatcaccagcaacagcagagcgagctg
cagccgcccgcgcccagtgaggatatctggaagaaattcgagctgcttcccaccccgccc
ctgtccccgagccgccgctccgggctctgctctccatcctatgttgcggtcgctacgtcc
ttctccccaagggaagacgatgacggcggcggtggcaacttctccaccgccgatcagctg
gagatgatgaccgagttacttggaggagacatggtgaaccagagcttcatctgcgatcct
gacgacgagaccttcatcaagaacatcatcatccaggactgtatgtggagcggtttctca
gccgctgccaagctggtctcggagaagctggcctcctaccaggctgcgcgcaaagacagc
accagcctgagccccgcccgcgggcacagcgtctgctccacctccagcctgtacctgcag
gacctcaccgccgccgcgtccgagtgcattgacccctcagtggtctttccctacccgctc
aacgacagcagctcgcccaaatcctgtacctcgtccgattccacggccttctctccttcc
tcggactcgctgctgtcctccgagtcctccccacgggccagccctgagcccctagtgctg
catgaggagacaccgcccaccaccagcagcgactctgaagaagagcaagaagatgaggaa
gaaattgatgtggtgtctgtggagaagaggcaaacccctgccaagaggtcggagtcgggc
tcatctccatcccgaggccacagcaaacctccgcacagcccactggtcctcaagaggtgc
cacgtctccactcaccagcacaactacgccgcacccccctccacaaggaaggactatcca
gctgccaagagggccaagttggacagtggcagggtcctgaagcagatcagcaacaaccgc
aagtgctccagccccaggtcctcagacacggaggaaaacgacaagaggcggacacacaac
gtcttggaacgtcagaggaggaacgagctgaagcgcagcttttttgccctgcgtgaccag
atccctgaattggaaaacaacgaaaaggcccccaaggtagtgatcctcaaaaaagccacc
gcctacatcctgtccattcaagcagacgagcacaagctcacctctgaaaaggacttattg
aggaaacgacgagaacagttgaaacacaaactcgaacagcttcgaaactctggtgcataa

DBGET integrated database retrieval system