KEGG   Mus musculus (mouse): 17877Help
Entry
17877             CDS       T01002                                 

Gene name
Myf5, B130010J22Rik, Myf-5, bHLHc2
Definition
(RefSeq) myogenic factor 5
  KO
K18484  myogenic factor 5
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    17877 (Myf5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    17877 (Myf5)
Transcription factors [BR:mmu03000]
 Eukaryotic Type
  Basic helix-loop-helix (bHLH)
   Myogenic transcription factors
    17877 (Myf5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myf5 Basic HLH
Motif
Other DBs
NCBI-GeneID: 17877
NCBI-ProteinID: NP_032682
MGI: 97252
Ensembl: ENSMUSG00000000435
UniProt: P24699 A2RSK4
LinkDB All DBs
Position
10 D1; 10 55.95 cM
AA seq 255 aa AA seqDB search
MDMTDGCQFSPSEYFYEGSCIPSPEDEFGDQFEPRVAAFGAHKAELQGSDDEEHVRAPTG
HHQAGHCLMWACKACKRKSTTMDRRKAATMRERRRLKKVNQAFETLKRCTTTNPNQRLPK
VEILRNAIRYIESLQELLREQVENYYSLPGQSCSEPTSPTSNCSDGMPECNSPVWSRKNS
SFDSIYCPDVSNACAADKSSVSSLDCLSSIVDRITSTEPSELALQDTASLSPATSANSQP
ATPGPSSSRLIYHVL
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atggacatgacggacggctgccagttctccccttctgagtacttctatgaaggctcctgt
atcccctcaccagaggatgagtttggggaccagtttgagccaagagtagcagccttcgga
gcacacaaagctgagctgcagggctcagacgatgaggagcacgtgcgtgcacctaccggc
caccaccaggctggccactgcctcatgtgggcctgcaaagcttgcaagaggaagtccact
accatggatcggcgcaaggccgccaccatgcgcgagcgtagacgcctgaagaaggtcaac
caagctttcgagacgctcaagaggtgcaccaccaccaaccctaaccagagactccccaag
gtggagatcctcaggaatgccatccgctacattgagagcctccaggagctgctgagggaa
caggtggagaactattacagcctgccgggacagagctgctctgagcccaccagccccacc
tccaactgctctgacggcatgcctgaatgtaacagccctgtctggtcccgaaagaacagc
agctttgacagcatctactgtcctgatgtatcaaatgcatgtgctgcagataaaagctcc
gtgtccagcttggattgcttgtccagcattgtggatcggatcacgtctacagagccatcc
gagctggctcttcaggacacagcttccctctctccagcgaccagcgccaactcacagcct
gctaccccgggaccctccagctccagacttatctatcacgtattatga

DBGET integrated database retrieval system