KEGG   Mus musculus (mouse): 17906Help
Entry
17906             CDS       T01002                                 

Gene name
Myl2, MLC-2, MLC-2s/v, MLC-2v, Mlc2v, Mylpc
Definition
(RefSeq) myosin, light polypeptide 2, regulatory, cardiac, slow
  KO
K10351  myosin regulatory light chain 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04260  Cardiac muscle contraction
mmu04261  Adrenergic signaling in cardiomyocytes
mmu04371  Apelin signaling pathway
mmu04510  Focal adhesion
mmu04530  Tight junction
mmu04670  Leukocyte transendothelial migration
mmu04810  Regulation of actin cytoskeleton
mmu05410  Hypertrophic cardiomyopathy (HCM)
mmu05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    17906 (Myl2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    17906 (Myl2)
   04530 Tight junction
    17906 (Myl2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    17906 (Myl2)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    17906 (Myl2)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    17906 (Myl2)
   04261 Adrenergic signaling in cardiomyocytes
    17906 (Myl2)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    17906 (Myl2)
   05414 Dilated cardiomyopathy (DCM)
    17906 (Myl2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    17906 (Myl2)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     17906 (Myl2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_1 EF-hand_6 EF-hand_7 EF-hand_8 EF-hand_5 EF-hand_11
Motif
Other DBs
NCBI-GeneID: 17906
NCBI-ProteinID: NP_034991
MGI: 97272
Ensembl: ENSMUSG00000013936
Vega: OTTMUSG00000024649
UniProt: P51667
LinkDB All DBs
Position
5; 5 F
AA seq 166 aa AA seqDB search
MAPKKAKKRIEGGSSNVFSMFEQTQIQEFKEAFTIMDQNRDGFIDKNDLRDTFAALGRVN
VKNEEIDEMIKEAPGPINFTVFLTMFGEKLKGADPEETILNAFKVFDPEGKGSLKADYVR
EMLTTQAERFSKEEIDQMFAAFPPDVTGNLDYKNLVHIITHGEEKD
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atggcaccaaagaaagccaagaagcggatagaaggcgggagctccaacgtgttctccatg
tttgagcagacccagatccaggagttcaaggaagccttcacaatcatggaccagaacaga
gacggcttcatcgacaagaatgacctaagggacacatttgctgccctaggacgagtgaac
gtgaaaaatgaagagatcgatgaaatgatcaaagaggctccaggtccaattaacttcacc
gtgttcctcacgatgtttggggagaaacttaaaggggctgatcctgaagagaccattctc
aacgcattcaaggtgtttgatcccgagggcaaagggtcactgaaggctgactatgtccgg
gagatgctgaccacacaagcagagaggttctccaaagaggagatcgaccagatgttcgca
gcctttccccctgacgtcaccggcaatcttgattataagaatttggtccacatcattacc
cacggagaagagaaggactga

DBGET integrated database retrieval system