KEGG   Mus musculus (mouse): 18014Help
Entry
18014             CDS       T01002                                 

Gene name
Neurog1, AKA, Math4C, Neurod3, bHLHa6, ngn1
Definition
(RefSeq) neurogenin 1
  KO
K09081  neurogenin 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    18014 (Neurog1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    18014 (Neurog1)
Transcription factors [BR:mmu03000]
 Eukaryotic Type
  Basic helix-loop-helix (bHLH)
   Tal/Twist/Atonal/Hen, Atonal
    18014 (Neurog1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HLH LELP1
Motif
Other DBs
NCBI-GeneID: 18014
NCBI-ProteinID: NP_035026
MGI: 107754
Ensembl: ENSMUSG00000048904
UniProt: P70660
LinkDB All DBs
Position
13 B1; 13 30.06 cM
AA seq 244 aa AA seqDB search
MPAPLETCISDLDCSSSNSSSDLSSFLTDEEDCARLQPLASTSGLSVPARRSAPALSGAS
NVPGAQDEEQERRRRRGRARVRSEALLHSLRRSRRVKANDRERNRMHNLNAALDALRSVL
PSFPDDTKLTKIETLRFAYNYIWALAETLRLADQGLPGGSARERLLPPQCVPCLPGPPSP
ASDTESWGSGAAASPCATVASPLSDPSSPSASEDFTYGPGDPLFSFPGLPKDLLHTTPCF
IPYH
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgcctgcccctttggagacctgcatctctgatctcgactgctccagcagcaacagcagc
agcgacctgtccagcttcctcaccgacgaggaggactgtgccaggctacagcccctagcc
tccacctcggggctgtccgtgccagcccggaggagcgctcccgccctctccggggcatcg
aatgttcccggtgcccaggacgaagagcaggaacggcggaggcggcgaggtcgcgctcgg
gtgcggtccgaggctctgctgcactccctgcggaggagtcgtcgcgtcaaagccaacgat
cgcgagcgcaaccgcatgcacaacctcaacgctgcgctggacgccttgcgcagcgtgctg
ccctcgttccccgacgacaccaagctcaccaagattgagacgctgcgcttcgcctacaac
tacatctgggccctggctgagacactgcgcctggcagatcaagggctccccgggggcagt
gcccgggagcgcctcctgcctccgcagtgtgtcccctgtctgcccgggcccccgagcccg
gccagcgacactgagtcctggggttccggggccgctgcctccccctgcgccactgtggca
tcaccactctctgaccccagtagtccctcggcttcagaagacttcacctatggcccgggc
gatccccttttctcctttcctggcctgcccaaagacctgctccacacgacgccctgtttc
atcccataccactag

DBGET integrated database retrieval system