KEGG   Mus musculus (mouse): 18015Help
Entry
18015             CDS       T01002                                 

Gene name
Nf1, AW494271, Dsk9, E030030H24Rik, Mhdadsk9, Nf-1
Definition
(RefSeq) neurofibromin 1
  KO
K08052  neurofibromin 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01521  EGFR tyrosine kinase inhibitor resistance
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    18015 (Nf1)
   04010 MAPK signaling pathway
    18015 (Nf1)
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    18015 (Nf1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RasGAP CRAL_TRIO_2 CRAL_TRIO MOR2-PAG1_C MIF4G_like_2
Motif
Other DBs
NCBI-GeneID: 18015
NCBI-ProteinID: NP_035027
MGI: 97306
Ensembl: ENSMUSG00000020716
Vega: OTTMUSG00000000164
UniProt: Q04690
LinkDB All DBs
Position
11 B5; 11 46.74 cM
AA seq 2841 aa AA seqDB search
MAAHRPVEWVQAVVSRFDEQLPIKTGQQNTHTKVSTEHNKECLINISKYKFSLVISGLTT
ILKNVNNMRIFGEAAEKNLYLSQLIILDTLEKCLAGQPKDTMRLDETMLVKQLLPEICHF
LHTCREGNQHAAELRNSASGVLFSLSCNNFNAVFSRISTRLQELTVCSEDNVDVHDIELL
QYINVDCAKLKRLLKETAFKFKALKKVAQLAVINSLEKAFWNWVENYPDEFTKLYQIPQT
DMAECAEKLFDLVDGFAESTKRKAAVWPLQIILLILCPEIIQDISKDVVDESNINKKLFL
DSLRKALAGHGGSRQLTESAAIACVKLCKASTYINWEDNSVIFLLVQSMVVDLKNLLFNP
SKPFSRGSQPADVDLMIDCLVSCFRISPHNNQHFKICLAQNSPSTFHYVLVNSLHRIITN
SALDWWPKIDAVYCHSVELRNMFGETLHKAVQGCGAHPAIRMAPSLTFKEKVTSLKFKEK
PTDLETRSYKCLLLSMVKLIHADPKLLLCNPRKQGPETQSSTAELITGLVQLVPQSHMPE
VAQEAMEALLVLHQLDSIDLWNPDAPVETFWEISSQMLFYICKKLTSHQMLSSTEILKWL
REILICRNKFLLKNKQADRSSCHSLYLYGVGCEMSATGNTTQMSVDHDEFLRACTPGASL
RKGRGNSSMDSTAGCSGTPPICRQAQTKLEVALYMFLWNPDTEAVLVAMSCFRHLCEEAD
IRCGVDEVSVHNFLPNYNTFMEFASVSNMMSTGRAALQKRVMALLRRIEHPTAGNIEAWE
DTHAKWEQATKLILNYPKAKMEDGQAAESLHKTIVKRRMSHVSGGGSIDLSDTDSLQEWI
NMTGFLCALGGVCLQQRSSSGLATYSPPMGAVSERKGSMISVMSSEGNIDSPVSRFMDRL
LSLMVCNHEKVGLQIRTNVKDLVGLELSPALYPMLFNKLKNTISKFFDSQGQVLLSDSNT
QFVEQTIAIMKNLLDNHTEGSSEHLGQASIETMMLNLVRYVRVLGNMVHAIQIKTKLCQL
VEVMMARRDDLSFCQEMKFRNKMVEYLTDWVMGTSNQAADDDIKCLTRDLDQASMEAVVS
LLAGLPLQPEEGDGVELMEAKSQLFLKYFTLFMNLLNDCSEVEDENAQTGGRKRGMSRRL
ASLRHCTVLAMSNLLNANVDSGLMHSIGLGYHKDLQTRATFMEVLTKILQQGTEFDTLAE
TVLADRFERLVELVTMMGDQGELPIAMALANVVPCSQWDELARVLVTLFDSRHLLYQLLW
NMFSKEVELADSMQTLFRGNSLASKIMTFCFKVYGATYLQKLLDPLLRVIITSSDWQHVS
FEVDPTRLEPSESLEENQRNLLQMTEKFFHAIISSSSEFPSQLRSVCHCLYQATCHSLLN
KATVKERKENKKSVVSQRFPQNSIGAVGSAMFLRFINPAIVSPYEAGILDKKPPPRIERG
LKLMSKVLQSIANHVLFTKEEHMRPFNDFVKSNFDLARRFFLDIASDCPTSDAVNHSLSF
ISDGNVLALHRLLWNNQEKIGQYLSSNRDHKAVGRRPFDKMATLLAYLGPPEHKPVADTH
WSSLNLTSSKFEEFMTRHQVHEKEEFKALKTLSIFYQAGTSKAGNPIFYYVARRFKTGQI
NGDLLIYHVLLTLKPYYAKPYEIVVDLTHTGPSNRFKTDFLSKWFVVFPGFAYDNVSAVY
IYNCNSWVREYTKYHERLLTGLKGSKRLIFIDCPGKLAEHIEHEQQKLPAATLALEEDLK
VFHNALKLAHKDTKVSIKVGSTAVQVTSAERTKVLGQSVFLNDIYYASEIEEICLVDENQ
FTLTIANQGTPLTFMHQECEAIVQSIIHIRTRWELSQPDSIPQHTKIRPKDVPGTLLNIA
LLNLGSSDPSLRSAAYNLLCALTCTFNLKIEGQLLETSGLCIPANNTLFIVSISKTLAAN
EPHLTLEFLEECISGFSKSSIELKHLCLEYMTPWLSNLVRFCKHNDDAKRQRVTAILDKL
ITMTINEKQMYPSIQAKIWGSLGQITDLLDVVLDSFIKTSATGGLGSIKAEVMADTAVAL
ASGNVKLVSSKVIGRMCKIIDKTCLSPTPTLEQHLMWDDIAILARYMLMLSFNNSLDVAA
HLPYLFHVVTFLVATGPLSLRASTHGLLINIIHSLCTCSQLHFSEETKQVLRLSLTEFSL
PKFYLLFGISKVKSAAVIAFRSSYRDRSFSPGSYERETFALTSLETVTEALLEIMEACMR
DIPTCKWLDQWTELAQRFAFQYNPSLQPRALVVFGCISKRVSHGQIKQIIRILSKALESC
LKGPDTYNSQVLIESTVIALTKLQPLLNKDSPLHKALFWVAVAVLQLDEVNLYSAGTALL
EQNLHTLDSLRIFNDKSPEEVFMAIRNPLEWHCKQMDHFVGLNFNSNFNFALVGHLLKGY
RHPSPAIVARTVRILHTLLTLVNKHRNCDKFEVNTQSVAYLAALLTVSEEVRSRCSLKHR
KSLLLTDISMENVPMDTYPIHHGDPSYRTLKETQPWSSPKGSEGYLAATYPAVGQTSPRA
RKSMSLDMGQPSQANTKKLLGTRKSFDHLISDTKAPKRQEMESGITTPPKMRRVAETDYE
METQRIPSSQQHPHLRKVSVSESNVLLDEEVLTDPKIQALLLTVLATLVKYTTDEFDQRI
LYEYLAEASVVFPKVFPVVHNLLDSKINTLLSLCQDPNLLNPIHGIVQSVVYHEESPPQY
QTSYLQSFGFNGLWRFAGPFSKQTQIPDYAELIVKFLDALIDTYLPGIDEETSEESLLTP
TSPYPPALQSQLSITANLNLSNSMTSLATSQHSPGLDKENVELSPTAGHCNSGRTRHGSA
SQVQKQRSAGSFKRNSIKKIV
NT seq 8526 nt NT seq  +upstreamnt  +downstreamnt
atggccgcacacaggccggtggaatgggtccaggccgtggtcagccgcttcgacgagcag
cttccaataaagacaggacagcagaacacacataccaaagtcagcaccgagcacaacaag
gagtgtctgatcaacatttccaaatacaagttttctctggtcatcagtgggctcaccacc
atcctaaagaatgttaacaatatgaggatatttggagaagctgctgaaaaaaatttgtat
ctctctcagttgatcatattggatacactggaaaaatgtcttgctgggcaaccaaaggac
acaatgagattagatgagacaatgctggtcaaacaattactaccagaaatctgccatttt
cttcacacctgccgtgaaggaaaccaacatgcagccgaacttcggaattctgcctctggg
gttttattttctctcagctgcaacaacttcaatgcagtctttagtcgcatttctacaagg
ttacaggagttgactgtctgttcagaagataatgttgatgttcacgatatagaattgtta
cagtatatcaatgtggattgtgcaaaattaaaacgacttctgaaggaaacagcatttaaa
tttaaagccctgaagaaggttgcacagttggcagttataaatagcctagaaaaggctttt
tggaactgggtagaaaattatccggatgaatttacaaagctataccaaattccacagaca
gatatggctgaatgtgcagagaagctgtttgacttggtggatggttttgcagaaagcacc
aaacgtaaagcagcagtgtggcccctacaaatcattctccttatcttgtgtccagaaata
atccaggacatctccaaggatgtggtggacgagagcaacataaacaagaagctgtttctg
gacagtttacggaaagcactcgctggccatggaggaagcaggcagctgactgagagtgct
gccattgcttgtgtcaagttgtgtaaagcaagtacttacatcaactgggaagataattct
gtcattttcctactggttcagtccatggtagttgatcttaagaacctgctttttaatcca
agtaaaccattctctagaggcagtcagcctgcagatgtggacctcatgattgactgtctt
gtctcttgctttcggataagccctcacaacaaccaacactttaagatctgcctggctcag
aattcaccttctacatttcactatgtgttggtaaactcactgcaccgcatcatcaccaat
tctgcgttggattggtggcctaagattgatgctgtatattgtcactcagttgaacttcgc
aatatgtttggtgaaacacttcataaagcagtgcaaggctgtggagcgcacccagcaata
cgaatggcaccaagtctcacctttaaagaaaaggtaacaagccttaaatttaaagaaaag
cctacagacctagagacaaggagctacaaatgtcttcttttgtccatggtgaaactgatt
catgcagacccaaagcttttgctttgtaatccaagaaaacagggccctgaaactcagagc
agtacagcagaactaattacagggctcgtacaactggttcctcagtcacacatgccagag
gtcgctcaggaggctatggaggctttgctggtccttcatcagttagatagcattgatctc
tggaatcctgacgctcctgtagagacattctgggaaatcagctcacaaatgcttttttac
atctgcaagaaattaactagccatcaaatgcttagtagcacagaaattctcaagtggtta
cgggaaattctgatctgcagaaataaatttcttcttaaaaataagcaggcagatagaagc
tcctgtcattctctctacctttatggagtaggatgtgaaatgtctgctactggaaatacc
actcagatgtcagttgatcatgatgagttcctgcgtgcctgtactcctggagcatctctg
cggaaaggaagagggaattcctccatggatagcacagcagggtgcagtggaaccccacct
atatgccgacaagcccagaccaagctagaagtggccttatacatgtttctgtggaatcct
gacactgaagctgttctggttgctatgtcctgtttccgccacctctgtgaagaagcagat
attcgatgtggggtagatgaagtgtcagtacacaacttcttgcccaactataacacattc
atggaatttgcctcagtcagcaatatgatgtcaacaggaagagcagcgcttcagaaaaga
gtgatggccctgctaaggcgcattgagcaccctactgcaggaaacattgaggcctgggaa
gatacacatgcaaagtgggaacaggctacaaaactaatccttaactacccaaaagccaaa
atggaagatggccaggctgcagaaagtcttcataagaccattgttaagagacggatgtcc
catgtcagtggaggaggctccatagacttgtctgacacagactccctgcaggagtggatc
aacatgactggcttcctttgtgcccttggtggggtgtgcctgcaacagagaagcagctct
ggcctagcgacatacagcccacctatgggcgctgtcagtgaacgcaaagggtctatgatt
tctgtaatgtcttctgaagggaatattgattcacctgtcagcagatttatggaccggctt
ctgtccttaatggtgtgtaaccacgagaaagtggggcttcagatacggaccaatgttaag
gacctggtgggtctggagttgagtcctgctctgtatccaatgctgtttaacaaactgaag
aataccatcagcaagttttttgactctcaaggacaggtattactaagtgacagcaatact
cagtttgtagagcaaaccatagccataatgaaaaacctactggataatcatactgaaggc
agctctgagcatctgggacaagcgagcattgagacaatgatgctaaatctggtcagatac
gttcgtgttcttgggaatatggtccatgcaatacaaataaaaacaaaattgtgtcagtta
gttgaagtcatgatggcaagaagagatgacctctcgttttgtcaagagatgaaatttagg
aataagatggtagaatatctaacagactgggttatgggaacatcaaaccaagcagcagat
gatgacataaaatgtcttacgagagatctggaccaagcaagcatggaagcagtagtttct
ctcctcgctggtcttccactgcagcccgaagaaggagatggggtggagctgatggaggcc
aaatcacagttattccttaagtacttcacattatttatgaaccttttgaatgactgtagt
gaagttgaagatgaaaatgcacaaacgggtggcaggaaacgtggcatgtctcggaggctg
gcatccctgaggcactgtacagtgcttgcaatgtcaaacttactcaatgctaatgtggac
agtggactcatgcactccataggcttaggttatcacaaggatcttcagacaagagctacg
tttatggaagttctgacaaaaatccttcaacaaggaacagaattcgatacacttgcggaa
acggtgttggcagatcgatttgagagacttgtggaactggtcacaatgatgggagaccag
ggagaactccctatagctatggctcttgccaatgtggtcccttgttctcagtgggatgag
ctggctcgggttctggtcactctgtttgattcccggcatttactctaccagctgctctgg
aacatgttttctaaggaggtagaattggcagactccatgcagactctctttcgaggcaac
agcttggccagtaagataatgacattctgcttcaaggtgtatggtgctacttacctacaa
aagctcttggaccctttattacgagtcatcatcacatcttcggattggcaacatgttagc
tttgaagtggatcctaccaggttagaaccctctgagagccttgaggagaaccagaggaac
ctccttcagatgacagagaagttcttccatgccatcatcagctcttcctcagaattcccc
tcacagcttcgaagtgtctgccattgtttgtaccaggcaacttgccactccctactgaat
aaagctacagtaaaagaaagaaaggaaaacaaaaaatcagtggttagccagcgcttccct
cagaacagcatcggtgccgtaggaagtgccatgtttctcagattcatcaatcctgccatt
gtctcgccgtatgaagcagggattttagataaaaagccaccacctagaattgaaaggggc
ttgaagttaatgtcaaaggtacttcagagcattgccaatcatgtactgttcacaaaagaa
gagcatatgagaccttttaatgattttgtgaaaagcaactttgacttggcacgaaggttt
ttcctagatatagcatcagattgtcccacaagtgatgcagtaaaccatagtctttccttc
atcagcgatggcaatgtgcttgctttacatcggctgctttggaacaatcaggagaaaatt
ggccagtatctttccagtaacagggatcataaagctgttggaagacgaccttttgataag
atggccacacttctcgcgtatctgggtcctccggagcacaagcctgtggcagatacacac
tggtccagccttaaccttaccagttcaaagtttgaggaatttatgaccaggcaccaggta
catgagaaagaagagttcaaggccttgaaaacgttaagcatcttctaccaagctggcacc
tccaaagctgggaatcctattttttattatgttgcacggaggttcaaaactggccagatc
aatggtgatctgctgatataccatgtcttgctgactttaaagccatattatgcaaagcca
tatgaaattgtagtggaccttacccatactgggcctagcaatcgctttaaaacagacttc
ctctctaagtggtttgttgtctttcctggctttgcctatgacaacgtctctgcagtctat
atctataactgtaactcctgggtcagggagtataccaaataccatgagcggctgctgact
ggcctcaagggcagcaaaaggctcattttcatcgactgtcctgggaagctggctgaacat
atagagcatgagcaacagaaactccctgctgctaccttggctttggaagaagatctaaag
gttttccacaatgctctcaagttagctcacaaggacaccaaagtttctattaaggttggt
tctactgctgttcaggtaacttcagcagaaagaacaaaagttttggggcaatccgtcttt
ttaaatgatatttactatgcttctgaaatcgaagagatctgcctagttgatgagaaccag
ttcactctaaccattgcaaaccaaggcacaccactgaccttcatgcaccaagaatgtgaa
gccattgttcagtctatcattcatatcaggacccgctgggagctgtcacaacctgactcc
atccctcagcataccaagattcgaccaaaggatgtccctgggacactgcttaatattgcg
ttactgaatttgggcagttcagaccctagtttacggtctgctgcctataatctcctgtgt
gccttaacctgcacctttaatttaaagattgaaggtcagttgctagagacatcggggtta
tgcatccctgccaacaacacactcttcattgtctctatcagtaagacgctcgcagccaat
gagccacacctcaccttagagtttttggaagagtgtatttctggatttagcaaatctagt
attgaattgaagcacctttgtttggaatatatgaccccatggctgtcaaatctagtccgt
ttttgtaagcataatgatgatgccaaacgacaaagggttactgccatccttgataagcta
ataacaatgactataaacgagaagcagatgtatccttctattcaagcaaaaatctggggg
agccttgggcagatcacagacctgctggatgttgtgcttgacagtttcatcaagaccagt
gcgacaggaggcttagggtctatcaaagctgaggtgatggcagacacagctgtggcttta
gcttctggaaatgtgaaattggtgtcgagtaaggttattggaaggatgtgtaaaataatt
gacaagacttgcttatccccaactccaactttagaacaacatcttatgtgggacgacatt
gccattttagcccgctacatgctgatgctgtccttcaacaactccctcgatgtggcggct
catctgccctatctcttccatgttgtcactttcttagtagccacaggtcccttgtccctc
cgagcttccacacatgggctgctcatcaatatcattcactctctgtgtacttgttctcag
cttcactttagtgaagagaccaagcaagttttgaggctcagtctaacagagttctcgtta
cccaaattttacttactgtttggcattagcaaagtcaagtcggctgctgtcattgccttc
cgttccagttaccgggaccgctccttctcccctggctcctatgagagggagacttttgct
ttgacgtccctggaaacagtcacagaagctttgttggagatcatggaggcatgtatgaga
gatattccaacatgcaagtggctggatcagtggacagaactagctcaaagatttgcgttt
cagtataacccatcgctgcagccaagagctcttgtggtgtttggctgtattagcaaacga
gtgtctcatgggcagataaagcagattatccgaattcttagcaaggcacttgaaagttgt
ttaaaaggacctgacacttacaacagtcaagttctgatagaatctacggtgatagcacta
acaaaattacagccgcttcttaataaggactcgcccctgcacaaagccctcttttgggtt
gctgtggctgtgctgcagctggacgaagtcaacttgtattcagccggcactgcacttctg
gaacaaaacctgcacaccttggacagtctccggatattcaatgacaagagtccggaagaa
gtatttatggcgatccggaatcctctggaatggcactgcaagcagatggatcactttgtc
ggactcaacttcaactctaactttaactttgcactagttggacacctcttaaaagggtac
aggcatccttcacctgccattgttgcaagaacagtcagaattttgcatacactactaact
ctcgttaacaaacatagaaattgtgacaaatttgaggtgaatacacagagtgtggcttac
ttagcagctctactcacagtgtctgaagaggttcgaagtcgctgtagcctcaagcatagg
aagtcccttcttcttactgatatttcaatggaaaatgttcctatggatacatatcccatt
catcacggtgaccccagctataggacactaaaggagacccagccatggtcctctcccaaa
ggttcagaaggataccttgcagccacctacccagctgtaggccaaaccagtccccgagcc
aggaaatccatgagcttggatatgggacagccttctcaggccaacacaaaaaaattgctt
ggaacaagaaaaagttttgatcacttgatatctgacacaaaggctcctaaaagacaagaa
atggaatcagggattacaacacccccgaaaatgagaagagtggcagagactgactatgaa
atggaaacccaaaggattccctcctcgcagcagcacccacatttacggaaagtctcagtc
tctgaatcaaatgttcttttggatgaagaagttcttaccgacccaaagatccaagcgctg
cttcttactgttctggctacactggtaaaatatactacagatgaatttgatcaacggatt
ctttatgaatatctagcagaggccagcgttgtgtttcccaaagtgtttcctgttgtgcac
aatttgttggactctaagatcaataccctcttgtctttatgccaagatccaaatttgtta
aatccaatccatggaattgtacagagtgtggtgtaccatgaggagtccccgccacagtac
cagacatcttacctgcaaagttttggttttaatggcttatggcggtttgcaggacccttt
tcaaagcaaacacaaatccctgactatgctgagctcattgttaaatttcttgatgccttg
attgacacgtacttgcctggaattgatgaagaaaccagtgaggagtccctcctgacaccc
acatctccttaccctcctgcactgcagagccagcttagtatcactgccaaccttaacctc
tctaattccatgacctcacttgcaacttcccagcattccccaggactcgacaaggagaac
gttgaactctcccccaccgctggccactgtaacagtggacggactcgccatggatccgca
agccaagtgcagaagcaaagaagtgctggcagtttcaaacgtaatagcattaagaagatc
gtgtga

DBGET integrated database retrieval system