KEGG   Mus musculus (mouse): 18024Help
Entry
18024             CDS       T01002                                 

Gene name
Nfe2l2, Nrf2
Definition
(RefSeq) nuclear factor, erythroid derived 2, like 2
  KO
K05638  nuclear factor erythroid 2-related factor 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04141  Protein processing in endoplasmic reticulum
mmu05200  Pathways in cancer
mmu05225  Hepatocellular carcinoma
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    18024 (Nfe2l2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    18024 (Nfe2l2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    18024 (Nfe2l2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    18024 (Nfe2l2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    18024 (Nfe2l2)
   03029 Mitochondrial biogenesis [BR:mmu03029]
    18024 (Nfe2l2)
Transcription factors [BR:mmu03000]
 Eukaryotic Type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, NF-E2
    18024 (Nfe2l2)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Nuclear respiratory factors
    18024 (Nfe2l2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: bZIP_Maf bZIP_1 bZIP_2
Motif
Other DBs
NCBI-GeneID: 18024
NCBI-ProteinID: NP_035032
MGI: 108420
Ensembl: ENSMUSG00000015839
Vega: OTTMUSG00000013248
UniProt: Q60795
LinkDB All DBs
Structure
PDB: 

Position
2 C3; 2 44.75 cM
AA seq 597 aa AA seqDB search
MMDLELPPPGLQSQQDMDLIDILWRQDIDLGVSREVFDFSQRQKDYELEKQKKLEKERQE
QLQKEQEKAFFAQFQLDEETGEFLPIQPAQHIQTDTSGSASYSQVAHIPKQDALYFEDCM
QLLAETFPFVDDHESLALDIPSHAESSVFTAPHQAQSLNSSLEAAMTDLSSIEQDMEQVW
QELFSIPELQCLNTENKQLADTTAVPSPEATLTEMDSNYHFYSSISSLEKEVGNCGPHFL
HGFEDSFSSILSTDDASQLTSLDSNPTLNTDFGDEFYSAFIAEPSDGGSMPSSAAISQSL
SELLDGTIEGCDLSLCKAFNPKHAEGTMEFNDSDSGISLNTSPSRASPEHSVESSIYGDP
PPGFSDSEMEELDSAPGSVKQNGPKAQPAHSPGDTVQPLSPAQGHSAPMRESQCENTTKK
EVPVSPGHQKAPFTKDKHSSRLEAHLTRDELRAKALHIPFPVEKIINLPVDDFNEMMSKE
QFNEAQLALIRDIRRRGKNKVAAQNCRKRKLENIVELEQDLGHLKDEREKLLREKGENDR
NLHLLKRRLSTLYLEVFSMLRDEDGKPYSPSEYSLQQTRDGNVFLVPKSKKPDTKKN
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atgatggacttggagttgccaccgccaggactacagtcccagcaggacatggatttgatt
gacatcctttggaggcaagacatagatcttggagtaagtcgagaagtgtttgactttagt
cagcgacagaaggactatgagctggaaaaacagaaaaaactcgaaaaggaaagacaagag
caactccagaaggaacaggagaaggccttttttgctcagtttcaactggatgaagaaaca
ggagaattcctcccaattcagccggcccagcacatccagacagacaccagtggatccgcc
agctactcccaggttgcccacattcccaaacaagatgccttgtactttgaagactgtatg
cagcttttggcagagacattcccatttgtagatgaccatgagtcgcttgccctggatatc
cccagccacgctgaaagttcagtcttcactgcccctcatcaggcccagtccctcaatagc
tctctggaggcagccatgactgatttaagcagcatagagcaggacatggagcaagtttgg
caggagctattttccattcccgaattacagtgtcttaataccgaaaacaagcagctggct
gatactaccgctgttcccagcccagaagccacactgacagaaatggacagcaattaccat
ttttactcatcgatctcctcgctggaaaaagaagtgggcaactgtggtccacatttcctt
catggttttgaggattctttcagcagcatcctctccactgatgatgccagccagctgacc
tccttagactcaaatcccaccttaaacacagattttggcgatgaattttattctgctttc
atagcagagcccagtgacggtggcagcatgccttcctccgctgccatcagtcagtcactc
tctgaactcctggacgggactattgaaggctgtgacctgtcactgtgtaaagctttcaac
ccgaagcacgctgaaggcacaatggaattcaatgactctgactctggcatttcactgaac
acgagtcccagccgagcgtccccagagcactccgtggagtcttccatttacggagaccca
ccgcctgggttcagtgactcggaaatggaggagctagatagtgcccctggaagtgtcaaa
cagaacggccctaaagcacagccagcacattctcctggagacacagtacagcctctgtca
ccagctcaagggcacagtgctcctatgcgtgaatcccaatgtgaaaatacaacaaaaaaa
gaagttcccgtgagtcctggtcatcaaaaagccccattcacaaaagacaaacattcaagc
cgcttagaggctcatctcacacgagatgagcttagggcaaaagctctccatattccattc
cctgtcgaaaaaatcattaacctccctgttgatgacttcaatgaaatgatgtccaaggag
caattcaatgaagctcagctcgcattgatccgagatatacgcaggagaggtaagaataaa
gtcgccgcccagaactgtaggaaaaggaagctggagaacattgtcgagctggagcaagac
ttgggccacttaaaagacgagagagaaaaactactcagagaaaagggagaaaacgacaga
aacctccatctactgaaaaggcggctcagcaccttgtatcttgaagtcttcagcatgtta
cgtgatgaggatggaaagccttactctcccagtgaatactctctgcagcaaaccagagat
ggcaatgtgttccttgttcccaaaagcaagaagccagatacaaagaaaaactag

DBGET integrated database retrieval system