KEGG   Mus musculus (mouse): 18034Help
Entry
18034             CDS       T01002                                 

Gene name
Nfkb2, NF-kappaB2, lyt, p49, p49/p100, p50B, p52
Definition
(RefSeq) nuclear factor of kappa light polypeptide gene enhancer in B cells 2, p49/p100
  KO
K04469  nuclear factor of kappa light polypeptide gene enhancer in B-cells 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04064  NF-kappa B signaling pathway
mmu04380  Osteoclast differentiation
mmu04625  C-type lectin receptor signaling pathway
mmu05134  Legionellosis
mmu05166  Human T-cell leukemia virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05200  Pathways in cancer
mmu05203  Viral carcinogenesis
mmu05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    18034 (Nfkb2)
   04064 NF-kappa B signaling pathway
    18034 (Nfkb2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    18034 (Nfkb2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    18034 (Nfkb2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    18034 (Nfkb2)
   05203 Viral carcinogenesis
    18034 (Nfkb2)
  09162 Cancer: specific types
   05224 Breast cancer
    18034 (Nfkb2)
  09171 Infectious disease: bacterial
   05134 Legionellosis
    18034 (Nfkb2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    18034 (Nfkb2)
   05169 Epstein-Barr virus infection
    18034 (Nfkb2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    18034 (Nfkb2)
Transcription factors [BR:mmu03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    18034 (Nfkb2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RHD_DNA_bind RHD_dimer Ank_2 Ank Ank_5 Ank_3 Ank_4 Death
Motif
Other DBs
NCBI-GeneID: 18034
NCBI-ProteinID: NP_001170840
MGI: 1099800
Ensembl: ENSMUSG00000025225
UniProt: Q9WTK5 Q3UG25 Q3UV15
LinkDB All DBs
Structure
PDB: 

Position
19 C3; 19 38.8 cM
AA seq 899 aa AA seqDB search
MDNCYDPGLDGIPEYDDFEFSPSIVEPKDPAPETADGPYLVIVEQPKQRGFRFRYGCEGP
SHGGLPGASSEKGRKTYPTVKICNYEGPAKIEVDLVTHSDPPRAHAHSLVGKQCSELGVC
AVSVGPKDMTAQFNNLGVLHVTKKNMMEIMIQKLQRQRLRSKPQGLTEAERRELEQEAKE
LKKVMDLSIVRLRFSAFLRASDGSFSLPLKPVISQPIHDSKSPGASNLKISRMDKTAGSV
RGGDEVYLLCDKVQKDDIEVRFYEDDENGWQAFGDFSPTDVHKQYAIVFRTPPYHKMKIE
RPVTVFLQLKRKRGGDVSDSKQFTYYPLVEDKEEVQRKRRKALPTFSQPFGGGSHMGGGS
GGSAGGYGGAGGGGSLGFFSSSLAYNPYQSGAAPMGCYPGGGGGAQMAGSRRDTDAGEGA
EEPRTPPEAPQGEPQALDTLQRAREYNARLFGLAQRSARALLDYGVTADARALLAGQRHL
LMAQDENGDTPLHLAIIHGQTGVIEQIAHVIYHAQYLGVINLTNHLHQTPLHLAVITGQT
RVVSFLLQVGADPTLLDRHGDSALHLALRAGAAAPELLQALLRSGAHAVPQILHMPDFEG
LYPVHLAVHARSPECLDLLVDCGAEVEAPERQGGRTALHLATEMEELGLVTHLVTKLHAN
VNARTFAGNTPLHLAAGLGSPTLTRLLLKAGADIHAENEEPLCPLPSPSTSGSDSDSEGP
ERDTQRNFRGHTPLDLTCSTKVKTLLLNAAQNTTEPPLAPPSPAGPGLSLGDAALQNLEQ
LLDGPEAQGSWAELAERLGLRSLVDTYRKTPSPSGSLLRSYKLAGGDLVGLLEALSDMGL
HEGVRLLKGPETRDKLPSTEVKEDSAYGSQSVEQEAEKLCPPPEPPGGLCHGHPQPQVH
NT seq 2700 nt NT seq  +upstreamnt  +downstreamnt
atggacaattgctacgatccaggcctggatggcatccccgaatatgatgattttgaattc
agcccctccatcgtggagcctaaggatccagcccctgagacagctgatggcccctatctg
gtgattgtggaacagcccaaacagcgaggcttcagatttcgatatggctgtgaaggcccc
tcccatggaggtttgccaggtgcctccagtgagaagggccggaagacctatcctactgtc
aagatctgtaactatgagggaccggccaagattgaggtggacctggtgacacacagtgac
ccacctcgtgcgcatgcccacagtctggtgggcaagcagtgttcagagttgggagtgtgc
gctgtgtctgtaggacccaaggacatgactgctcaatttaataatctgggtgtcctgcat
gtaaccaagaagaacatgatggagattatgatccagaaacttcagaggcagcgtctccgc
tccaagcctcagggccttacagaggctgagcggcgggagctagagcaggaggccaaggag
ctgaagaaagtcatggatctgagcattgtacggctgcgcttctcagctttccttcgagct
agcgatggctccttctccttgcccctgaagcctgtgatctcccagcccatccatgacagc
aagtctccaggggcctcgaacctgaagatctcccgaatggacaagacagcgggttccgtg
cgcggtggagacgaagtttatttgctctgtgataaggtgcaaaaagacgacattgaggtt
cggttctatgaggatgatgagaatggatggcaagcctttggggacttctctcccacagac
gttcataaacagtatgccattgtgttccggacaccgccctatcacaagatgaagatcgag
aggcctgtaacggtgttcctgcagctgaaacgcaagcgtgggggcgatgtctcggactcc
aaacagttcacatattaccctctggtggaagacaaggaggaagtgcagaggaagcggaga
aaggccttgcccaccttctcccagcccttcgggggcggatcccacatgggtggaggttct
gggggctccgctgggggttatggaggcgctggaggaggtggcagcctcggctttttctcc
tcctccttggcctacaacccctaccaatccggtgcagccccaatgggctgctatccgggt
gggggaggtggagcgcagatggccggttctagacgggacaccgatgctggcgagggggca
gaggagcccaggacgcccccggaggctccccagggcgaaccacaggcccttgacacactg
cagcgagctcgcgagtacaacgcgcgcctgttcggtctggcgcagcgcagcgcccgagcg
ttgctggactacggcgtcaccgcagacgcgcgtgctctgctagcgggacagcgccacctg
ctgatggcacaggacgagaacggagacacgccactgcacctggccatcatccatgggcag
actggtgtcattgagcagatagcccacgtcatttatcacgctcagtacctcggcgtcatc
aacctcaccaaccacctgcaccagacgcctctgcacctggcggtaatcactgggcagaca
agggtggtgagcttcctgctgcaggtgggtgcagaccccacgctgctggatcggcacgga
gactccgccctccacttggctctccgggcaggtgctgcagccccagagctgttgcaggca
ctgttgcgcagcggagcccatgctgtgccccaaatattgcacatgcctgattttgaggga
ctataccctgtacacctggcagtccatgcccgaagccctgagtgcctggatctgttagtt
gactgtggagctgaagtggaggccccagagaggcaagggggccgaactgccctgcatcta
gccacagagatggaggagttggggctggtcacccatctagtcaccaagctccatgctaat
gtgaatgcccggacctttgctggaaacacacccctccacctggcagctggactcgggtcc
ccaactcttactcgcctccttctaaaggctggtgctgacatccatgcagagaatgaggag
cctctgtgcccgctgccctcaccctcgacctctgggagcgactccgactctgaagggcct
gagagggatacccaaagaaacttccgaggccatacccctcttgacctcacttgcagtacc
aaggtgaagactctgctgctaaatgctgctcagaacaccacggagccacccctggcccca
cccagccctgcagggccagggctgtccctgggggatgcagccctgcagaacctggagcaa
ctgctggatggtcccgaagcccagggcagctgggcagagctggcagagcgactggggttg
agaagcctggtggacacatacaggaagaccccgtctcccagcggcagtctccttcgtagt
tacaagctggctggtggggacttggtgggtctattggaggccttgtctgacatgggtctc
catgagggagtcaggctgctgaaaggtcctgagacccgcgacaagctgcccagcacagag
gtgaaagaagacagtgcctatgggagccagtcagtggagcaggaggcagagaagctgtgt
ccaccccctgagcctccaggagggctctgccacgggcacccccagcctcaggtgcactga

DBGET integrated database retrieval system