KEGG   Mus musculus (mouse): 18035Help
Entry
18035             CDS       T01002                                 

Gene name
Nfkbia, AI462015, Nfkbi
Definition
(RefSeq) nuclear factor of kappa light polypeptide gene enhancer in B cells inhibitor, alpha
  KO
K04734  NF-kappa-B inhibitor alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04024  cAMP signaling pathway
mmu04062  Chemokine signaling pathway
mmu04064  NF-kappa B signaling pathway
mmu04210  Apoptosis
mmu04380  Osteoclast differentiation
mmu04620  Toll-like receptor signaling pathway
mmu04621  NOD-like receptor signaling pathway
mmu04622  RIG-I-like receptor signaling pathway
mmu04623  Cytosolic DNA-sensing pathway
mmu04625  C-type lectin receptor signaling pathway
mmu04657  IL-17 signaling pathway
mmu04658  Th1 and Th2 cell differentiation
mmu04659  Th17 cell differentiation
mmu04660  T cell receptor signaling pathway
mmu04662  B cell receptor signaling pathway
mmu04668  TNF signaling pathway
mmu04722  Neurotrophin signaling pathway
mmu04920  Adipocytokine signaling pathway
mmu04926  Relaxin signaling pathway
mmu04931  Insulin resistance
mmu05134  Legionellosis
mmu05135  Yersinia infection
mmu05140  Leishmaniasis
mmu05142  Chagas disease (American trypanosomiasis)
mmu05145  Toxoplasmosis
mmu05160  Hepatitis C
mmu05161  Hepatitis B
mmu05162  Measles
mmu05163  Human cytomegalovirus infection
mmu05164  Influenza A
mmu05166  Human T-cell leukemia virus 1 infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05200  Pathways in cancer
mmu05203  Viral carcinogenesis
mmu05215  Prostate cancer
mmu05220  Chronic myeloid leukemia
mmu05222  Small cell lung cancer
mmu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    18035 (Nfkbia)
   04668 TNF signaling pathway
    18035 (Nfkbia)
   04024 cAMP signaling pathway
    18035 (Nfkbia)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    18035 (Nfkbia)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    18035 (Nfkbia)
   04621 NOD-like receptor signaling pathway
    18035 (Nfkbia)
   04622 RIG-I-like receptor signaling pathway
    18035 (Nfkbia)
   04623 Cytosolic DNA-sensing pathway
    18035 (Nfkbia)
   04625 C-type lectin receptor signaling pathway
    18035 (Nfkbia)
   04660 T cell receptor signaling pathway
    18035 (Nfkbia)
   04658 Th1 and Th2 cell differentiation
    18035 (Nfkbia)
   04659 Th17 cell differentiation
    18035 (Nfkbia)
   04657 IL-17 signaling pathway
    18035 (Nfkbia)
   04662 B cell receptor signaling pathway
    18035 (Nfkbia)
   04062 Chemokine signaling pathway
    18035 (Nfkbia)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    18035 (Nfkbia)
   04926 Relaxin signaling pathway
    18035 (Nfkbia)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    18035 (Nfkbia)
  09158 Development
   04380 Osteoclast differentiation
    18035 (Nfkbia)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    18035 (Nfkbia)
   05203 Viral carcinogenesis
    18035 (Nfkbia)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    18035 (Nfkbia)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    18035 (Nfkbia)
   05215 Prostate cancer
    18035 (Nfkbia)
   05222 Small cell lung cancer
    18035 (Nfkbia)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    18035 (Nfkbia)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    18035 (Nfkbia)
   05134 Legionellosis
    18035 (Nfkbia)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    18035 (Nfkbia)
   05170 Human immunodeficiency virus 1 infection
    18035 (Nfkbia)
   05162 Measles
    18035 (Nfkbia)
   05164 Influenza A
    18035 (Nfkbia)
   05161 Hepatitis B
    18035 (Nfkbia)
   05160 Hepatitis C
    18035 (Nfkbia)
   05168 Herpes simplex virus 1 infection
    18035 (Nfkbia)
   05163 Human cytomegalovirus infection
    18035 (Nfkbia)
   05167 Kaposi sarcoma-associated herpesvirus infection
    18035 (Nfkbia)
   05169 Epstein-Barr virus infection
    18035 (Nfkbia)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    18035 (Nfkbia)
   05140 Leishmaniasis
    18035 (Nfkbia)
   05142 Chagas disease (American trypanosomiasis)
    18035 (Nfkbia)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    18035 (Nfkbia)
   04131 Membrane trafficking [BR:mmu04131]
    18035 (Nfkbia)
Transcription factors [BR:mmu03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Ankyrin only
    18035 (Nfkbia)
Membrane trafficking [BR:mmu04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    18035 (Nfkbia)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_2 Ank Ank_5 Ank_3 Ank_4
Motif
Other DBs
NCBI-GeneID: 18035
NCBI-ProteinID: NP_035037
MGI: 104741
Ensembl: ENSMUSG00000021025
UniProt: Q9Z1E3
LinkDB All DBs
Position
12; 12 C1
AA seq 314 aa AA seqDB search
MFQPAGHGQDWAMEGPRDGLKKERLVDDRHDSGLDSMKDEEYEQMVKELREIRLQPQEAP
LAAEPWKQQLTEDGDSFLHLAIIHEEKPLTMEVIGQVKGDLAFLNFQNNLQQTPLHLAVI
TNQPGIAEALLKAGCDPELRDFRGNTPLHLACEQGCLASVAVLTQTCTPQHLHSVLQATN
YNGHTCLHLASIHGYLAIVEHLVTLGADVNAQEPCNGRTALHLAVDLQNPDLVSLLLKCG
ADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQMLPESEDEESYDTESEFTEDEL
PYDDCVFGGQRLTL
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgtttcagccagctgggcacggccaggactgggccatggagggcccgcgggatggcctc
aagaaggagcgcttggtggacgatcgccacgacagcggcctggactccatgaaggacgag
gagtacgagcaaatggtgaaggagctgcgggagatccgcctgcagccgcaggaggcgccg
ctggccgccgagccctggaagcagcagctcacggaggacggagactcgttcctgcacttg
gcaatcatccacgaagagaagccgctgaccatggaagtcattggtcaggtgaagggagac
ctggccttcctcaacttccagaacaacctgcagcagactccactccacttggctgtgatc
accaaccagccaggaattgctgaggcacttctgaaagctggctgtgatcctgagctccga
gactttcgaggaaatacccctctacatcttgcctgtgagcagggctgcctggccagtgta
gcagtcttgacgcagacctgcacaccccagcatctccactccgtcctgcaggccaccaac
tacaatggccacacgtgtctgcacctagcctctatccacggctacctggccatcgtggag
cacttggtgactttgggtgctgatgtcaacgctcaggagccctgcaatggccggacagcc
ctccaccttgcggtggacctgcagaatcctgacctggtttcgctcttgttgaaatgtggg
gctgatgtcaacagggtaacctaccaaggctactccccctaccagcttacctggggccgc
ccaagtacccggatacagcagcagctgggccagctgaccctggaaaatctccagatgcta
cccgagagcgaggatgaggagagctatgacacggagtcagaattcacagaggatgagctg
ccctatgatgactgtgtgtttggaggccagcgtctgacattataa

DBGET integrated database retrieval system