KEGG   Mus musculus (mouse): 18095Help
Entry
18095             CDS       T01002                                 

Gene name
Nkx3-1, Bax, NKX3.1, NKX3A, Nkx-3.1, bagpipe
Definition
(RefSeq) NK3 homeobox 1
  KO
K09348  homeobox protein Nkx-3.1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05200  Pathways in cancer
mmu05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    18095 (Nkx3-1)
  09162 Cancer: specific types
   05215 Prostate cancer
    18095 (Nkx3-1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    18095 (Nkx3-1)
Transcription factors [BR:mmu03000]
 Eukaryotic Type
  Helix-turn-helix
   Homeo domain only, NK-2
    18095 (Nkx3-1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Homeodomain Homeobox_KN Homez
Motif
Other DBs
NCBI-GeneID: 18095
NCBI-ProteinID: NP_035051
MGI: 97352
Ensembl: ENSMUSG00000022061
Vega: OTTMUSG00000037540
UniProt: P97436 Q3UVH8
LinkDB All DBs
Position
14 D2; 14 36.02 cM
AA seq 237 aa AA seqDB search
MLRVAEPREPRVEAGGRSPWAAPPTQSKRLTSFLIQDILRDRAERHGGHSGNPQHSPDPR
RDSAPEPDKAGGRGVAPEDPPSIRHSPAETPTEPESDAHFETYLLDCEHNPGDLASAPQV
TKQPQKRSRAAFSHTQVIELERKFSHQKYLSAPERAHLAKNLKLTETQVKIWFQNRRYKT
KRKQLSEDLGVLEKNSPLSLPALKDDSLPSTSLVSVYTSYPYYPYLYCLGSWHPSFW
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgcttagggtagcggagccccgagagccacgggtggaggcgggtggccgcagtccttgg
gcagcgccacccacgcagtccaagcggctcacctccttcctcatccaggacatcctgcgg
gaccgcgcggagcggcacgggggacactcaggcaatccgcagcactcgccggaccctagg
agggactccgctccagagcccgacaaagcagggggtcgcggcgtggctccggaggaccca
ccaagtatccggcatagccccgcggagacaccgactgaacccgagtctgatgcacatttt
gagacttatcttttggactgtgaacataatccaggggacttagcaagtgccccccaggtc
accaagcagccacagaagcgctcccgggccgccttctctcacactcaggtgattgagttg
gagaggaagttcagccatcagaagtacctgtctgcccctgagagggctcacctggccaag
aacctcaaactcaccgaaacccaagtcaaaatatggttccagaacagacgctataagacc
aagcgaaagcagctgtcggaagacctgggagtcttggagaagaactcaccattgtctttg
ccagccctgaaagatgacagcctgcccagtacctccttggtctccgtgtatactagctat
ccctactacccctacctgtactgtctgggcagctggcatccatctttctggtag

DBGET integrated database retrieval system