KEGG   Mus musculus (mouse): 18104Help
Entry
18104             CDS       T01002                                 

Gene name
Nqo1, AV001255, Dia4, Dtd, Nmo-1, Nmo1, Nmor1, Ox-1, Ox1, Qr1
Definition
(RefSeq) NAD(P)H dehydrogenase, quinone 1
  KO
K00355  NAD(P)H dehydrogenase (quinone) [EC:1.6.5.2]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00130  Ubiquinone and other terpenoid-quinone biosynthesis
mmu01100  Metabolic pathways
mmu05200  Pathways in cancer
mmu05225  Hepatocellular carcinoma
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    18104 (Nqo1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    18104 (Nqo1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    18104 (Nqo1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    18104 (Nqo1)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.2  NAD(P)H dehydrogenase (quinone)
     18104 (Nqo1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Flavodoxin_2 FMN_red
Motif
Other DBs
NCBI-GeneID: 18104
NCBI-ProteinID: NP_032732
MGI: 103187
Ensembl: ENSMUSG00000003849
Vega: OTTMUSG00000022884
UniProt: Q64669 Q542Y0
LinkDB All DBs
Structure
PDB: 

Position
8 D3; 8 54.08 cM
AA seq 274 aa AA seqDB search
MAARRALIVLAHSEKTSFNYAMKEAAVEALKKRGWEVLESDLYAMNFNPIISRNDITGEL
KDSKNFQYPSESSLAYKEGRLSPDIVAEHKKLEAADLVIFQFPLQWFGVPAILKGWFERV
LVAGFAYTYAAMYDNGPFQNKKTLLSITTGGSGSMYSLQGVHGDMNVILWPIQSGILRFC
GFQVLEPQLVYSIGHTPPDARMQILEGWKKRLETVWEETPLYFAPSSLFDLNFQAGFLMK
KEVQEEQKKNKFGLSVGHHLGKSIPADNQIKARK
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgagaagagccctgattgtactggcccattcagagaagacatcattcaactac
gccatgaaggaggctgctgtagaggctctgaagaagagaggatgggaggtactcgaatct
gacctctatgctatgaacttcaaccccatcatttccagaaatgacatcacaggtgagctg
aaggactcgaagaactttcagtatccttccgagtcatctctagcatataaggaaggacgc
ctgagcccagatattgtggccgaacacaagaagctggaagctgcagacctggtgatattt
cagttcccattgcagtggtttggggtgccagccattctgaaaggctggtttgagagagtg
ctcgtagcaggatttgcctacacatatgctgccatgtacgacaacggtcctttccagaat
aagaagaccttgctttctatcaccactgggggtagcggctccatgtactctcttcagggt
gtccacggggacatgaacgtcattctctggccgattcagagtggcatcctgcgtttctgt
ggcttccaggtcttagaacctcaactggtttacagcattggccacactccaccagatgcc
cgcatgcagatcctggaaggatggaagaaacgtctggaaaccgtctgggaggagacccca
ctctattttgctccaagcagcctgtttgacctaaactttcaggcaggattcttaatgaaa
aaggaagttcaagaggagcagaagaagaacaagtttggcctctctgtgggccatcacctg
ggcaagtccattccagctgacaaccagatcaaagctagaaaataa

DBGET integrated database retrieval system