KEGG   Mus musculus (mouse): 18119Help
Entry
18119             CDS       T01002                                 

Gene name
Nodal, Tg.413d
Definition
(RefSeq) nodal
  KO
K04666  nodal
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04350  TGF-beta signaling pathway
mmu04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    18119 (Nodal)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    18119 (Nodal)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    18119 (Nodal)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:mmu04052]
    18119 (Nodal)
Cytokines and growth factors [BR:mmu04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   18119 (Nodal)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TGF_beta TGFb_propeptide
Motif
Other DBs
NCBI-GeneID: 18119
NCBI-ProteinID: NP_038639
MGI: 97359
Ensembl: ENSMUSG00000037171
Vega: OTTMUSG00000021483
UniProt: P43021
LinkDB All DBs
Position
10 B4; 10 32.21 cM
AA seq 354 aa AA seqDB search
MSAHSLRILLLQACWALLHPRAPTAAALPLWTRGQPSSPSPLAYMLSLYRDPLPRADIIR
SLQAQDVDVTGQNWTFTFDFSFLSQEEDLVWAELRLQLPGPMDIPTEGPLTIDIFHQAKG
DPERDPADCLERIWMETFTVIPSQVTFASGSTVLEVTKPLSKWLKDPRALEKQVSSRAEK
CWHQPYTPPVPVASTNVLMLYSNRPQEQRQLGGATLLWEAESSWRAQEGQLSVERGGWGR
RQRRHHLPDRSQLCRRVKFQVDFNLIGWGSWIIYPKQYNAYRCEGECPNPVGEEFHPTNH
AYIQSLLKRYQPHRVPSTCCAPVKTKPLSMLYVDNGRVLLEHHKDMIVEECGCL
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcccacagcctccgcatccttcttcttcaagcctgttgggctctactccacccg
cgcgccccgaccgcggccgctttgcctctgtggacacgggggcagccctcgtcaccgtcc
cctctggcgtacatgttgagcctctaccgagacccgctgcctcgggcggacatcatccgc
agcctccaggcgcaagatgtggacgtgaccggacagaactggactttcacgtttgacttc
tcttttttgagccaagaagaggatctggtatgggcggagctccggttgcagctgccgggc
cccatggacatacccactgagggcccactcaccattgacattttccaccaggccaagggg
gatccagagcgggaccccgctgactgcctggagcgcatttggatggagacgttcaccgtc
attccttctcaggtcacgtttgcctcaggcagcacagtcctggaggtgaccaagccactc
tccaagtggctaaaggaccccagggcactggaaaagcaggtgtccagtcgagcagaaaag
tgttggcatcagccctacaccccacctgtacctgtcgccagcaccaatgtgctcatgctc
tactccaaccggcctcaggagcagaggcagctagggggcgccactttgctttgggaagct
gagagctcctggcgggcccaggagggacagctgtctgtagagaggggcggatggggcaga
aggcaacgccgacatcatttgccagacagaagccaactgtgtaggagggtcaagttccag
gtggacttcaacctgattggctggggctcctggatcatctaccccaagcagtacaatgcc
tatcgctgtgagggcgagtgtcctaaccctgtgggggaggagtttcatcctaccaaccat
gcctacatccagagcctgctgaaacgataccaaccccaccgggttccttccacgtgctgt
gcccccgtgaagaccaagccactgagcatgctttatgtggacaatggcagggtcctcctg
gaacaccacaaggacatgattgtggaggagtgtgggtgcctctga

DBGET integrated database retrieval system